Поксвирусние онколитические вектори

 

Область техніки

Онколитические віруси являють собою клас нових терапевтичних речовин, що використовуються для лікування раку, володіють унікальною здатністю до опухоле-залежному самозабезпечення (HERMISTON. A demand for next-generation oncolytic adenoviruses. Current opinion in molecular therapeutics. 2006, vol.8, no.4, p.322-30). Онколитические віруси здатні до селективного реплікації в злоякісних клітинах і тому пропонують рівні сили дії та специфічності, які потенційно набагато перевищують стандартні протиракові терапії (FISHER. Striking out at disseminated metastases: the delivery of systemic oncolytic viruses. Current opinion in molecular therapeutics. 2006, vol.8, no.4, p.301-13). Перевага використання цих вірусів полягає в тому, що при своїй реплікації вони лизируют своїх клітин-господарів. Ракові клітини - ідеальні господарі для багатьох вірусів, тому у них инактивирован антивірусний интерфероновий шлях або мутовані гени-супресори пухлини, які дозволяють безперешкодно протікати вірусної реплікації (CHERNAJOVSKY, et al. Fighting cancer with oncolytic viruses. British medical journal. 2006, vol.332, no.7534, p.170-2).

Деякі віруси за природою здатні селективно правильно в пухлинних клітинах, але онколитические віруси можуть також бути отримані шляхом модифікації природних вірусів. З цією метою главщественних вірусних генах; пухлина - чи тканині-специфічні промотери, використовувані для контролю експресії цих вірусних генів; і модифікація тропізму, щоб перенаправити аденовірус на поверхню ракової клітини. У найближчому майбутньому необхідно оптимізувати онколитические аденовіруси, щоб повністю реалізувати їхній потенціал як критичних протиракових інструментів і, таким чином, поліпшити прогноз для пацієнтів зі злоякісними гліомами (JIANG et al. Oncolytic adenoviruses as antiglioma agents. Expert review of anticancer therapy. 2006, vol.6, no.5, p.697-708).

Наприклад, ONYX-015, селективно модифікований аденовірус для реплікації і знищення клітин, які мають p53 мутації, що розробляється компанією «Onyx Pharmaceuticals» для потенційного лікування різних солідних пухлин, включаючи пухлини голови і шиї, шлунково-кишкові та панкреатичні пухлини. Він являє собою рекомбінантний аденовірус, який несе мутацію «втрати функції» в локусі E1B, продуктом якої є 55 кДа білок, який зв'язується з p53 пухлинним білком-супресором та інактивує його. Таким чином, аденовірус ONYX-015, як передбачається, не вражає нормальні клітини. Мутації в гені p53-супрессоре пухлини являють собою найбільш розповсюджений тип генетичної п� сприйнятливі до вірусу, який буде легко правильно і викликати смерть клітини. Тривають дослідження фази III застосування ONYX-015 щодо лікування рецидивуючого раку голови та шиї, дослідження фази II - щодо лікування колоректальної пухлини, пухлин яєчника, підшлункової залози і ротової порожнини, і дослідження фази I - щодо хвороб органів травлення, пухлин стравоходу і печінки (COHEN et al. ONYX-015. Onyx Pharmaceuticals. Current opinion in investigational drugs. 2001, vol.2, no.12, p.1770-5).

Природні онколитические віруси являють собою реплікація-компетентні віруси, що володіють вродженою здатністю селективно заражати і знищувати клітини пухлини. Незважаючи на те що вони використовувалися в оригінальних спробах лікувати рак живими вірусами п'ять десятиліть тому, інтерес до природних онколитическим вірусів відстав від підтримки створених генною інженерією аденовірусів та вірусів герпесу в якості терапії раку. Однак нещодавно був відновлений інтерес до високої сили дії та селективності цих природних агентів (ROBERTS, et al. Naturally oncolytic viruses. Current opinion in molecular therapeutics. 2006, vol.8, no.4, p.314-21).

Серед природних онколитических вірусів віруси осповакцини (Poxviridae) володіють багатьма з ключових ознак, необхідних для ідеальні оригінальні та свя�дення, з швидким міжклітинних розповсюдженням, сильну політично здатність, більшу здатність до клонування і чітку молекулярну біологію. Крім того, хоча вони здатні до реплікації в клітинах людини, їх не вважають природного проблемою для здоров'я та особливо добре характеризуються тим, що їх вводили мільйонам людей під час кампанії по знищенню віспи. Ранні клінічні результати, використовують або штами вакцини, або генетично модифіковані штами осповакцини, продемонстрували протипухлинні ефекти (THORNE, et al. Vaccinia virus and oncolytic virotherapy of cancer. Current opinion in molecular therapeutics. 2005, vol.7, no.4, p.359-65).

Навпаки, поксвирус миксоми є новим онколитическим кандидатом, у якого немає ніякої історії безпосереднього використання у людей, оскільки він володіє відмітним і абсолютним тропізмом до виду-господаря по відношенню до лагоморфам (кроликів). Вірус миксоми, як нещодавно показано, може також селективно заражати і знищувати людські пухлинні клітини, унікальний тропізм, який пов'язаний з дисрегулированними внутрішньоклітинними сигнальними шляхами, виявлений у більшості людських ракових утворень. Цей огляд змальовує в загальних рисах існуючі дані відне його здатність заражати і знищувати пухлини на тваринних моделях раку (STANFORD, et al. Myxoma virus and oncolytic virotherapy: a new biologic weapon in the war against cancer. Expert opinion on biological therapy. 2007, vol.7, no.9, p.1415-25).

Технічна проблема

Ін'єкція високих доз поксвирусов, необхідна для досягнення протипухлинного ефекту, викликала проблеми, пов'язані з токсичністю. Більшість несприятливих явищ являють собою незначні несприятливі реакції, які зазвичай пов'язані з вірусом осповакцини, обмежені і включають лихоманку, головний біль, втома, міальгію, озноб, місцеві шкірні реакції, неспецифічну висип, мультиформна еритема, збільшення лімфатичних вузлів і біль у ділянці щеплення. Інші реакції могли б вимагати додаткових методів лікування (наприклад, VIG, терапія першої лінії і цидофовир, терапія другої лінії). Несприятливі реакції, які могли б зажадати подальшої оцінки або терапії, що включають ненавмисну інокуляцію, генералізовану коров'ячу віспу (GV), екзему після щеплення (EV), прогресуючу коров'ячу віспу (PV), поствакцинальної хвороба центральної нервової системи та ембріональну коров'ячу віспу (CONO, et al. Smallpox vaccination and adverse reactions. Guidance for clinicians. MMWR. Recommendations and reports: Morbidity and mortality weekly report. Recommendations and reports / Centers for Disease Control. 2003, vol.52, no. RR-4, p.1-28).

Таким чином, сущЋх копій.

Передумови створення винаходу

В US 5364773 (VIROGENETICS CORPORATION (TROY, NY)) 15/11/1994 описують модифікований рекомбінантний поксвирус, особливо вірус коров'ячої віспи, що має інактивовані несуттєві закодовані вірусом генетичні функції таким чином, щоб рекомбінантний поксвирус володів зменшеною токсичністю і підвищеною безпекою. Зокрема, генетичні функції инактивировани шляхом делеції відкритої рамки зчитування, кодує фактор вірулентності, або інсерційної інактивацією відкритої рамки зчитування, кодує фактор вірулентності. Більш детально цей патент описує вірус осповакцини, в якому відкрита рамка зчитування для J2R, B13R+B14R, A26L, A56R, C7L - K1L, і I4L була інактивована. Цей вірус (NYVAC) може бути спроектований як вектор для чужорідної нуклеїнової кислоти і використовуватися в якості вакцини для того, щоб викликати імунологічний відповідь у тваринному-господаря. Однак NYVAC нездатний ефективно правильно в більшості клітин ссавців і не може використовуватися як онколитический вірус (XIANGZHI, et al. Vaccinia virus K1L protein supports viral replication in human and rabbit cells through a cell-type-specific set of its ankyrin repeat residues that are distinct from its binding site for ACAP2. Journal of virology. 2006, vol.353, no.1, p.220-233.).�акцій у його вірусному геномі. Описані мутації знаходяться в одному або декількох з наступних класів поліпептидів: 1) інтерферон-модулюючий поліпептид; 2) комплемент-контрольний поліпептид; 3) TNF або хемокин-модулюючий поліпептид; 4) інгібітор серинової протеази; 5) IL-1p-модулюючий поліпептид; 6) неінфекційні EEV форми поліпептидів; 7) вірусний поліпептид, який діє для інгібування вивільнення інфекційного вірусу з клітин (протиінфекційний вірусна форма поліпептиду). Крім того, також розкриті мутації у вірусі осповакцини A41L або C11R.

Ділянки геному осповакцини, такі як A34R, A41L, A53R, B5R, B7R, B8R, B13R, B15R, B18R, B22R, B28R, B29R, CUR, E3L, K2L, N1L, vC12L, vCKBP більш докладно описані в цій заявці. Способи винаходу втягують використання будь-якого з поксвирусов, обговорених авторами. Винахідники також розкривають способи для лікування раку шляхом введення в клітину або пацієнту ефективного кількості цього зміненого вірусу осповакцини.

Розкриття винаходу

Винахідники на подив виявили, що поксвируси, що включають дефектний F2L ген, мають покращений профіль безпеки, але зберігають еквівалентну онколитическую активність (порівняно з їх природною копією).

Даний винахід му числі використовуються у значенні, що вони мають на увазі "принаймні один", "принаймні перший", "один або кілька" або "безліч" компонентів або кроків, на які посилаються, якщо контекст не ясно вказує інакше. Наприклад, термін "клітина" включає безліч клітин, включаючи їх суміші.

Термін "та/або", що використовується авторами, включає значення "і", "або" і "все або будь-яка інша комбінація елементів, пов'язаних зазначеним терміном".

Термін "біля" або "приблизно", що використовується авторами, позначає в межах 20%, переважно в межах 10% і більш переважно в межах 5% цього значення або діапазону.

Використовувані авторами терміни "включають" і "включають" означають, що продукти, композиції і способи включають компоненти або стадії, на які посилаються, але виключають інші. "Складається по суті з", використовуваний для визначення продуктів, композицій і способів, повинен означати виключення інших компонентів або стадій будь-якого суттєвого значення. Таким чином, композиція, що складається по суті з перерахованих компонентів, не виключає забруднювачі в слідових кількостях і фармацевтично прийнятні носії. "Складається із" повинен означати виняток більше ніж елементи в слідових количеотносится до поксвирусу, включає делеції, заміни або доповнення однієї або декількох нуклеїнових кислот дефектного гена, або будь-якої комбінації цих можливостей, причому зазначені модифікації призводять до нездатності для вірусу продукувати білок, що має активність білка, виробленого немодифікованим геном. У кращому варіанті здійснення винаходу поксвирус, що включає дефектний ген, що стосується поксвируса, в якому була видалена ціла генна послідовність. Мутація може бути здійснена багатьма способами, відомими кваліфікованим фахівцям в даній області техніки, використовуючи рекомбінантні методи. Методи для модифікації геному поксвируса доступні в даній області. Наприклад, методи, розкриті в MCCART, et al. Systemic cancer therapy with a tumor selective vaccinia virus mutant lacking thymidine kinase and vaccinia growth factor genes. Cancer res. 2001, no.61, p.8751-57., KIM et al. Systemic armed oncolytic ans immunologic therapy for cancer with JX-594, a targeted poxvirus expressing GM-CSF. Molecular Therapeutic. 2006, no.14, p.361-70, WO 2004/014314 (KIRN DAVID (US)) 19/02/2004 і US 5364773 (VIROGENETICS CORPORATION (TROY, NY)) 15/11/1994 можуть використовуватися, щоб зробити поксвирус винаходу. Способи, розкриті в прикладі даної заявки, особливо ставляться до отримання поксвируса згідно винаходу. Послідовності геному різних поксвирусов дост�руса миксоми, доступні в Genbank (інвентарний номер NC_006998, NC_003663, NC_005309, NC_004105, NC_001132, відповідно).

Використовується авторами термін "поксвирус" відноситься до вірусу, що належить до сімейства Poxviridae. Згідно кращого варіанту здійснення поксвирус згідно винаходу належить до підродини Chordopoxvirinae, більш переважно роду Orthopoxvirus і ще більш переважно до виду вірусу Vaccinia.

Наприклад, можуть використовуватися штами вірусу осповакцини Dairen I, IHD-J, L-IPV, LC16M8, LC16MO, Lister, LIVP, Tashkent, WR 65-16, Wyeth, Ankara, Copenhagen, Tian Tan та WR. Згідно особливо кращого варіанту здійснення поксвирус згідно винаходу являє собою штами Copenhagen вірусу осповакцини. Поксвирус осповакцини містить великий подвійний геном ДНК (187 пар килооснований) і є членом єдиного відомого сімейства ДНК вірусів, яка реплікується в цитоплазмі інфікованих клітин. Оскільки інфікована клітина повинна поставити велику кількість попередників ДНК в цитоплазматичні ділянки реплікації, вірус кодує і экспрессирует багато ферментативних активностей, необхідних для метаболізму і синтезу ДНК, включаючи дезоксіурідіна 5'-трифосфат-нуклеотидогидролазу (dUTPase).

Дезоксіурідіна 5'-трифосфа�а, при видаленні dUTP з пулу dNTP і виробництва dUMP, залучена і підтримання відданості реплікації ДНК і надання попередника для виробництва ТМР тимидилатсинтазой. dUTPаза осповакцини являє собою 15-кДа білок, закодований геном F2L (MCGEOGH. Nucleic Acids Research. 1990, no.18, p.4105-10; BROYLES. Virology. 1993, no.195, p.863-5). Послідовність гена F2L вірусу осповакцини доступна в генному банку за інвентарним номером М25392, послідовності і розташування гена F2L в геномах різних поксвирусов також доступні в генному банку, наприклад, за інвентарним номером NC_006998, DQ121394, NC_001611, AY689436, AY689437, NC_008291, DQ437594, DQ437593, AY313847, AY313848, NC_006966, NC_005309, NC_003391, NC_003389, NC_001132, NC_003310, NC_002188, M35027, AY243312, AF170726, DQ011157, DQ011156, DQ011155, DQ011154, DQ011153, X94355, Y16780, AY318871, U94848, AF198100 і M34368.

Генна номенклатура, використовувана в даному описі, є номенклатурою штаму Copenhagen осповакцини і використовується також для гомологічних генів інших poxviridae, якщо не зазначено інакше. Однак генна номенклатура може відрізнятися в залежності від штаму віспи. Для отримання інформації, відповідності між генами Copenhagen і MVA, див. Таблицю I ANTOINE. Virology. 1998, no.244, р. 365-396.

Згідно кращого варіанту здійснення поксвирус даного винаходу додатково включає дефектні�езоксирибонуклеотида піримідину. Реакція, що каталізується ТК, залучає перенос γ - фосфорилостатка з АТР на 2'дезокси - тимидин (dThd), щоб зробити тимидин 5'-монофосфат (dTMP). ТК вірусу осповакцини має тип 2. ТК типу 2 мають меншу полипептидную ланцюг порівняно з типом 1, ~25 кДа, але формують гомотетрамери. Вони чутливі до інгібіторів зворотного зв'язку dTDP або dTTP, які генеруються в кінці метаболічного шляху. У ТК типу 2 більш вузька специфічність до субстрату порівняно з ТК типу 1 і тільки фосфорилат 2'дезоксиуридин (dU) та/або dThd (EL OMARI, et al. Structure of vaccinia virus thymidine kinase in complex with dTTP insights for drug design. BMC structural biology. 2006, no.6, p.22).

Поксвируси, дефектні на ділянці J2R, та методи їх отримання доступні в даній області техніки. Наприклад, керівництво MCCART, et al. Systemic cancer therapy with a tumor-selective vaccinia virus mutant lacking thymidine kinase and vaccinia growth factor genes. cancer research. 2001, vol.61, no.24, p.8751-7, PUHLMANN, et al. Vaccinia as a vector for tumor-directed gene therapy: biodistribution of a thymidine kinase-deleted mutant. Cancer gene therapy. 2000, vol.7, no.1, p.66-73, GNANT, et al. Systemic administration of a recombinant vaccinia virus expressing the cytosine deaminase gene and subsequent treatment with 5-fluorocytosine leads to tumor-specific gene expression and prolongation of survival in mice. Cancer Research. 1999, vol.59, no.14, p.3396-403 може використовуватися для отримання поксвирусов з делецією ділянки J2R.

Згідно кращого варіанту втілення поксвирус узгод�щення цільова нуклеїнова кислота містить принаймні одну цільову послідовність, кодує генний продукт, який є терапевтичної молекулою (тобто терапевтичним геном).

"Терапевтична молекула" є молекулою, яка має фармакологічної або захисною активністю при належному введення пацієнту, особливо пацієнту, який страждає від хворобливого стану або хвороби або того, кого слід захистити від цієї хвороби чи стану. Така фармакологічна або захисна активність являє собою активність, яка, як очікують, буде пов'язана зі сприятливим впливом на хід або симптом зазначеної хвороби або зазначеного стану. Коли кваліфікований фахівець вибирає в ході існуючого винаходу ген, що кодує терапевтичну молекулу, він взагалі пов'язує свій вибір з раніше отриманими результатами та може розумно очікувати, без надмірного експерименту, крім здійснення винаходу згідно формули, отримати таке фармакологічна властивість. Згідно винаходу цільова послідовність може бути гомологічною або гетерологичной мишеневим клітин, в які вона вводиться. Переважно вказана послідовність кодує весь або частину поліпептиду, особливо терапевтичний або профилактиче�бим трансляційний продуктом полинуклеотида незалежно від розміру, і незалежно від глікозилювання, і включає пептиди та білки. Терапевтичні поліпептиди включають як первинний приклад ті поліпептиди, які можуть компенсувати дефектні або недосконалі білки в тваринному або людському організмі, або ті, які діють через токсичні ефекти для обмеження або видалення шкідливих клітин з організму. Вони можуть також бути додають иммунность поліпептидами, які діють як ендогенний антиген, щоб викликати гуморальний або клітинний відповідь, або і той, і інший.

Приклади поліпептидів, закодованих терапевтичним геном, включають гени, що кодують цитокін (альфа, бета або гамма-інтерферон, інтерлейкін, особливо IL-2, IL-6, IL-10 або IL-12, фактор некрозу пухлини (TNF), колоние-стимулюючий фактор GM-CSF, C-CSF, M-CSF...), иммуностимуляторний поліпептид (В7.1, В7.2 тощо), фактор коагуляції (FVIII, FIX...), фактор росту (трансформуючий фактор росту TGF, фактор росту фібробластів FGF тощо), фермент (уреаза, ренін, тромбін, металлопротеиназа, синтаза оксиду азоту NOS, SOD, каталаза...), інгібітор ферменту (альфа-1-антитрипсин, антитромбін III, вірусний інгібітор протеази, інгібітор активатора плазміногену PAI-1), та cftr (регулятор трансмембранного провідності кістозного фіб�ь експресію клітинних генів, поліпептид, здатний до пригнічення бактеріальної, паразитної або вірусної інфекції або її розвитку (антигенні поліпептиди, антигенні епітопи, трансдоминантние варіанти, які інгібують дію нативного білка шляхом конкуренції....), індуктор або інгібітор апоптозу (Bax, Bc12, BclX...), цитотоксичний агент (р21, р16, Rb...), аполіпопротеїн (ApoAI, ApoAIV, АроЕ...), інгібітор ангіогенезу (ангиостатин, эндостатин...), ангиогенний поліпептид (сімейство судинних ендотеліальних факторів зростання VEGV, сімейство FGF, сімейство CCN, включаючи CTGF, Cyr61 та Nov), поглинач кисневих радикалів, поліпептид, що має антиопухолевий ефект, антитіло, токсин, иммунотоксин і маркер (бета-галактозидаза, люцифераза....) або будь-які інші цільові гени, визнані в даній області техніки як корисні для лікування або запобігання клінічного стану.

Відповідні протипухлинні гени включають, крім інших, гени, які кодують гени-супресори пухлини (наприклад, Rb, p53, DCC, NF-1, пухлина Вільма, NM23, BRUSH-1, p16, p21, p56, p73, а також їх відповідні мутанти), продукти суїцидальної гена, антитіла, олипептиди, інгібуючі клітинне ділення або сигнали трансдукції.

Згідно особливо кращого варіанту втілення поксвир�рующего білок, здатний перетворити попередник лікарського препарату в цитотоксичное з'єднання.

Суїцидальні гени включають, крім інших, гени, що кодують білок, що має цитозин-дезаминазную активність, тимидин-киназную активність, урацил-фосфорибозильную трансферазную активність, пуриннуклеозид-фосфорилазную активність і/або тимидилат-киназную активність.

Приклади суїцидальних генів і відповідні попередники лікарського препарату, що включає один залишок нуклеооснования, розкриті в наступній таблиці:

Цитозиндезаминаза
Таблиця 1
Суїцидальний генПроліки
ТимідинкіназаГанцикловір;
ефір ганцикловір элаидовой кислоти;
пенцикловир;
Суїцидальний генПроліки
ацикловір;
валацикловір;
(Е)-5-(2-бромвинил)-2'-дезоксіурідіна;
5-Фторцитозин
Пуриннуклеозидфосфорилаза6-метилпуриндезоксирибозид;
флударабин
Урацилфосфорибозилтрансфераза5-Фторцитозин;
5-фтороурацил
ТимидилаткиназаАзидотимідин

Згідно кращого варіанту втілення винаходу суїцидальний ген кодує білок, що має принаймні активність CDази. CDаза залучена в пиримидиновий метаболічний шлях, по якому екзогенний цитозин перетворюється в урацил допомогою гідролітичного дезамінування. У той час як активності СDази були продемонстровані в прокариотах і нижчих эукариотах (JUND, et al.. Journal of Bacteriology. 1970, no.102, p.607-15; BECK, et al. Journal of Bacteriology. 1972, no.110, p.219-28; HOEPRICH, et al. Journal of Infectious Diseases. 1974, no.130, p.112-18; ESDERS, et al. J. товарbiol. chem. 1985, no.260, p.3915-22), вони не присутні у ссавців (KOECHLIN, et al. Біохімічний pharmacology. 1966, no.15, p.435-46; POLAK, et al. Chemotherapy. 1976, no.22, p.137-53).

CDаза також дезаминирует аналог цитозина, тобто 5-фторцитозин (5-FC), такипри його перетворення на 5-фтор-UMP (5-FUMP). Клітини, які не мають активності CDази, або через мутації, яка інактивує ген, що кодує фермент, або тому що у них природно немає цього ферменту, як у клітин ссавців, є резистентними до 5-FC (JUND, et al. Journal of Bacteriology. 1970, no.102, p.607-15; KILLSTRUP, et al. Journal of Bacteriology. 1989, no.171, p.2124-2127). На відміну від цього клітини ссавців, які були перенесені послідовності, що кодують активність СDази, стали чутливими до 5-FC (HUBER, et al. Cancer Research. 1993, no.53, p.4619-4626; MULLEN, et al. Proceedings of the National Academy of Sciences of the United States of America. 1992, no.89, p.33-37; WO 93/01281 (US HEALTH)). Крім того, сусідні, непреобразованние клітини також стають чутливими до 5-FC (HUBER, et al. Proceedings of the National Academy of Sciences of the United States of America. 1994, no.91, p.8302-6). Це явище, яке називають ефектом «свідка», походить із клітин, які експресують активність CDази, секретируючих 5-FU, який интоксицирует сусідні клітини шляхом прямої дифузії через плазматическую мембрану. Це властивість 5-FU щодо пасивної дифузії являє перевагу порівняно з tk/GCV еталонною системою, в якій ефект «свідка» вимагає контакту з клітинами, які експресують tk (MESNIL, et al. Proceedings of the National Academy of Sciences of the United States of America. 1996, no.93, p.1831-35). Всі переваги,ожуть тому бути легко зрозумілі.

Гени codA Saccharomyces cerevisiae (S. cerevisiae) FCY1, Candida Albicans FCA1 і E. coli, які відповідно кодують CDазу цих двох організмів, відомі, і їх послідовності були опубліковані (SEQ ID N°: 4; SEQ ID N°: 5; SEQ ID N°: 6 відповідно).

В цьому відношенні відповідно більш кращого варіанту втілення цього винаходу ген, що кодує білок, що має активність CDази, є FCY1, FCA1 або CodA або їх аналогом. Аналоги цих генів стосуються гена, що має послідовність нуклеїнової кислоти, у якій ступінь ідентичності, принаймні, більше ніж 70%, переважно більше ніж 80%, переважно більше ніж 90% і найвпевненіше більше ніж 95% з послідовністю нуклеїнової кислоти батьківського гена.

Патент WO 2005/007857 описує ген, що кодує білок, який має поліпшену активність CDази. Ці поліпептиди отримані з нативної CDази шляхом доповнення амінокислотної послідовності. Згідно з іншим кращого варіанту втілення даного винаходу білок, що має активність CDази, являє собою поліпептид, розкритий в WO 2005/007857, і більш переважно поліпептид FCU1-8, представлений в ідентифікаторі послідовності SEQ ID N°: 2, і їх аналоги.

У прокариотах і нижчих эукаращает 5-FU у 5-FUMP. Згідно з іншим кращого варіанту втілення цього винаходу суїцидальний ген кодує білок, що має активність UPRТази.

Розглянута UPRTаза може мати будь походження, особливості прокариотическое походження, грибкове або дріжджове походження. За допомогою ілюстрації послідовності нуклеїнової кислоти, що кодують, UPRTази з Є. coli (ANDERSEN, et al. Characterization of the upp gene encoding uracil phosphoribosyltransferase of Escherichia coli K12. European Journal of Biochemistry. 1992, no.204, p.51-56), Lactococcus lactis (MARTINUSSEN, et al. Cloning and characterization of upp, a gene encoding uracil phosphoribosyltransferase from Lactococcus lactis. Journal of Bacteriology. 1994, vol.176, no.21, p.6457-63), Mycobacterium bovis (KIM et al. Complete sequence of the UPP gene encoding uracil phosphoribosyltransferase from Mycobacterium bovis BCG. Biochemistry and molecular biology international. 1997, vol.41, no.6, p.1117-24) і з Bacillus subtilis (MARTINUSSEN, et al. Two genes encoding uracil phosphoribosyltransferase are present in Bacillus subtilis. Journal of Bacteriology. 1995, vol.177, no.1, p.271-4) може використовуватися в контексті винаходу. Однак найбільше особливо переважно використовувати дріжджову UPRTазу і в особливості закодовану S. cerevisiae FUR1 геном, послідовність якого розкрита в KERN, et al. The FUR1 gene of Saccharomyces cerevisiae: cloning, structure and expression of wild-type and mutant alleles. Gene. 1990, vol.88, no.2, p.149-57, який вводиться авторами за допомогою посилання. В якості керівництва последоватециалистов (SWISSPROT, EMBL, Genbank, Medline тощо).

Заявка EP 0998568 A описує ген FUR1, не має 105 нуклеотидів в 5' кодуючої частини, що дозволяє синтез UPRTази, з якої були видалені 35 перших залишків N-термінальному стані та починаючи з метіоніну в положенні 36 в нативному білку. Продукт експресії гена - мутанта під назвою FUR1Δ105, здатний до комплементированию fur1 мутанта S. cerevisiae. Крім того, усічений мутант показує більш високу активність UPRTази, ніж така для нативного ферменту. Таким чином, згідно особливо кращого варіанту втілення цього винаходу суїцидальний ген кодує мутант делеції нативної UPRTази. Делеція переважно розташована в N-термінальної області оригінальної UPRTази. Вона може бути повною (зачіпає всі залишки зазначеної N-термінальної області) або частковою (воздействующей на один або кілька безперервних або переривчастих залишків в первинній структурі). Взагалі, поліпептид складається з N-термінальної, центральної і C-термінальної частин, кожна з яких представляє приблизно одну третину молекули. Наприклад, оскільки UPRTаза S. cerevisiae має 251 амінокислоту, її N-термінальна частина складається з перших 83 залишків, що починаються з так званого ініціатора мехвативает положення 1-69.

Переважний білок, що має активність UPRTази, включає аминокислотную послідовність, практично таку, як представлена в ідентифікаторі послідовності SEQ ID N°: 1 з EP 0998568 A, починається з залишку Met в положенні 1 і закінчується залишком Val у положенні 216. Термін "практично" відноситься до ступеня ідентичності з вказаною послідовністю SEQ ID N°: 1 EP 0998568 більше ніж 70%, переважно більше ніж 80%, переважно більше ніж 90% і найвпевненіше більше ніж 95%. Все ще більш переважно вона включає аминокислотную послідовність, представлену в ідентифікаторі послідовності SEQ ID N°: 1 EP 0998568 A. Як згадано вище, вона може включати додаткові мутації. Особливо, може бути згадана заміна залишку серину в положенні 2 (37 положення в нативної UPRTазе) на аланиновий залишок.

Згідно з іншим кращого варіанту втілення цього винаходу суїцидальний ген кодує білок, що має принаймні одну активність CDази і одну активність UPR-Тази. Патентні заявки WO 96/16183 і EP 0998568 A описують використання злитого білка, що кодує фермент з двома доменами, що мають активності CDази і UPRTази, і демонструють, що перенесення гибриднЌ трансфекованих В16 клітин до 5-FC. Згідно більш кращого варіанту втілення цього винаходу суїцидальний ген кодує поліпептид, що включає аминокислотную послідовність, практично таку, як представлена в ідентифікаторі послідовності SEQ ID N°: 3 (coda::upp), SEQ ID N°: 1 (FCU1) або FCY1::FUR1. Термін "практично" відноситься до ступеня ідентичності з вказаною послідовністю, більше ніж 70%, переважно більше ніж 80%, переважно більше ніж 90% і найвпевненіше більше ніж 95%. Все ще більш переважно, вона включає аминокислотную послідовність, практично таку, як представлена в ідентифікаторі послідовності SEQ ID N°: 3 (coda::upp), SEQ ID N°: 1 (FCU1) або FCY1::FUR1. Як згадано вище, вона може включати додаткові мутації.

Нуклеиновокислотние послідовності можуть бути легко отримані шляхом клонування, ПЛР або хімічним синтезом згідно звичайним використовуваних способів. Вони можуть бути нативними генами або генами, отриманими з них шляхом мутації, делеції, заміни та/або доповнення одного або кількох нуклеотидів. Крім того, їх послідовності широко описані в літературі, до якої можуть звернутися спеціалісти, кваліфіковані в даній галузі техніки. Спеціалі�підставі опублікованих даних і можливі мутації, тестувати ферментативну активність мутантних форм в безклітинній або клітинної системі відповідно до технології з попереднього рівня техніки або засновані на протоколі, визначеному в заявці EP 0998568 A, і сплавити, особливо у фазі, поліпептиди з активністю CDази і UPRTази, і, отже, із усіма або частиною відповідних генів.

Згідно більш кращого варіанту втілення поксвирус винаходу додатково включає нуклеиновокислотную послідовність, що включає ген, що кодує пермеазу.

Пермеаза стосується трансмембранного білка, залученого до перенесення лікарського препарату, що включає один залишок нуклеооснования, або його попередника через клітинну мембрану.

Пермеаза включає, але не обмежена перерахованими, пуринпермеазу, цитозинпермеазу і транспортери нуклеозиду.

Згідно кращого варіанту втілення даного винаходу пермеаза являє собою пурин або цитозинпермеазу S. Cerevisiae. Транспортери нуклеооснования S. cerevisiae складаються з пурин-цитозин пермеази, відомої як FCY2, і урацилпермеази, відомої як FUR4. Пурин-цитозин пермеаза FCY2 опосередковує симпорт протонів і аденіну, гуаніна, гіпоксантину і цитозіна че�редует також транспорт 5-фторцитозина, аналога цитозина (Grenson 1969, Jund and Lacroute 1970). FCY2 ген кодує білок з 533 амінокислот (58 кДа), як спочатку передбачалося, має 10-12 трансмембранних обертових доменів (Weber et al. 1990), дев'ять з яких на сьогоднішній день схвалені (Ferreira et al. 1999). FCY2 показує подібні спорідненості для пуринових нуклеооснований і цитозіна (Brethes et al. 1992). Захоплення урацилу у S. cerevisiae опосередковується урацилпермеазой, FUR4 (Jund and Lacroute 1970, Jund et al. 1977). FUR4 являє собою урацил-протонний симпортер (Hopkins et al. 1988), який, мабуть, є білком з 633 амінокислот (71,7 кДа) з 10 трансмембранними доменами і довгими цитоплазматичними гідрофільними N - і C-термінальними хвостами (Jund et al. 1988, Garnier et al. 1996). Білок FUR4 може опосередкувати транспорт 5-фтороурацила, аналога урацилу (Jund and Lacroute 1970).

Амінокислотні послідовності FCY2 і Fur4 особливо доступні в базі даних swissprot (інвентарний номер Р17064 і Р05316 відповідно). Переважно, пермеаза має аминокислотную послідовність, обрану з групи, що включає аминокислотную послідовність SEQ ID N0: 1 і SEQ ID N0: 2, як розкрито в патентній заявці WO 2006/048768.

В цьому відношенні згідно кращого варіанту втілення даного винаходу пермеаза вибирається з групи, вк�ть, яка має ступінь ідентичності, принаймні, більше ніж 70%, переважно більше ніж 80%, переважно більше ніж 90% і найвпевненіше більше ніж 95%, з амінокислотною послідовністю батьківського білка, як описано вище авторами, і які зберігають здатність транспортувати лікарський препарат, що включає один залишок нуклеооснования через клітинну мембрану.

Спеціаліст, кваліфікований у даній області техніки, може вибрати пермеазу, яка буде пов'язана з препаратом або попередником препарату, що включає один залишок нуклеооснования. Наприклад, FCY2 і Fur4 переважно зв'язуються з 5-фторцитозином (5-FC).

Відповідно до більш кращим варіантом втілення поксвирус винаходу може додатково включати елементи, необхідні для експресії цільової нуклеїнової кислоти.

Відповідно до більш кращим варіантом втілення поксвирус винаходу може додатково включати елементи, необхідні для експресії нуклеиновокислотной послідовності, що включає ген, що кодує пермеазу. Ці елементи, необхідні для експресії цільової нуклеїнової кислоти і/або нуклеиновокислотной последовательнои, у разі необхідності, для трансляції мРНК в поліпептид. Транскрипционние промотери, що підходять для використання в різних системах хребетних, широко описані в літературі. Наприклад, серед відповідних промоторів вірусні промотери, такі як RSV, MPSV, SV40, CMV або 7,5 k, промоутер осповакцини, индуцибельние промотери і т. д. Кращі промотери ізолюються з поксвирусов, наприклад 7.5 ДО, H5R, ТК, р28, p11 або K1L вірусу осповакцини. Альтернативно, можна використовувати синтетичний промоутер, такий, як описано в CHAKRABARTI. Biotechniques. 1997, no.23, р. 1094-97, HAMMOND, et al. Journal of Virological Methods. 1997, no.66, p.135-38. і KUMAR. Virology. 1990, no.179, p.151-8, а також химерні промотери між ранніми і пізніми поксвирусними промотерами.

Цільова нуклеиновокислотная послідовність і нуклеиновокислотная послідовність, що включає ген, що кодує пермеазу, можуть додатково включати додаткові функціональні елементи, такі як послідовності інтрона, нацеливающие послідовності, транспортні послідовності, сигнал секреції, ядерний сигнал локалізації, IRES, полі А послідовності термінації транскрипції, тристоронні лидерние послідовності, послідовності, залучені в реплікацію або інтеграцію. �і фахівцями в даній області техніки.

Винахід також стосується способу для отримання поксвируса згідно з винаходом, у якому спосіб:

(i) поксвирус згідно винаходу вводять у клітину,

(ii) зазначену клітку культивують при умовах, які є відповідними для того, щоб дозволити продукцію зазначеного поксвируса, і

(iii) зазначений поксвирус виділяють з клітинної культури.

У той час як поксвирус може, звичайно, бути виділений з супернатанту культури, він також може бути виділений із клітин. Один з найчастіше використовуваних способів полягає в розкладанні клітин за допомогою послідовних циклів заморожування/розморожування, щоб зібрати віріони в лизисний супернатант. Потім ці віріони можуть бути амплифицировани і очищені з використанням способів з даної галузі техніки (хроматографічний метод, метод ультрацентрифугирования, в особливості через градієнт хлориду цезію, тощо).

Справжній винахід також стосується композиції, яка включає поксвирус згідно з винаходом в комбінації з фармацевтично прийнятним допоміжним речовиною.

Композиція згідно з винаходом більш виразно призначена для профілактичного або излечивающеЋе освіти, пухлини, рестеноз і т. д.) або націлені на хвороби, пов'язані із збільшеною активністю остеокластів (наприклад, ревматоїдний артрит, остеопороз).

Композиція згідно з винаходом може бути зроблена традиційно в цілях її введення локально, парентерально або травним шляхом. Зокрема, терапевтично ефективна кількість рекомбінантного вектора або поксвируса даного винаходу комбінують з фармацевтично прийнятним допоміжним речовиною. Можливо передбачити велику кількість шляхів введення. Приклади, які можуть бути згадані, включають внутрішньошлунковий, підшкірний, внутрисердечний, внутрішньом'язовий, внутрішньовенний, внутрибрюшинний, внутрішньопухлинний, інтраназальний, внутрилегочний і внутритрахеальний шляху. У випадку цих останніх трьох варіантів втілення переважно, щоб введення відбувалося з допомогою аерозолю або з допомогою інсталяції. Введення може відбуватися у вигляді єдиної дози або дози, яка повторюється в одному або декількох випадках після певного тимчасового інтервалу. Відповідний шлях введення і дозування змінюється залежно від багатьох параметрів, наприклад, таких як пацієнт, хвороба, яку будуть гласно винаходу, можуть бути сформульовані у формі доз, що становлять від 104до 1014pfu (бляшкообразующая одиниця), переважно від 105до 1013pfu, переважно від 106до 1012pfu, більш переважно від 106до 107.

Композиція може також включати розчинник, ад'ювант або допоміжна речовина, яке є прийнятним з фармацевтичної точки зору, а також солюбилизирующее, стабілізуючий засіб і консервант. У разі ін'єкційного введення перевага віддається композиції у водному, неводному або ізотонічному розчині. Вона може бути представлена у вигляді одноразової дози або мультідози, у рідкому або сухому вигляді (порошок, порошок тощо), яка може бути приготована під час використання за допомогою відповідного розчинника.

Справжній винахід також стосується використання поксвируса або композиції згідно винаходу для приготування лікарського засобу, який призначений для лікування організму людини або тварин генною терапією. Цей лікарський засіб можна вводити безпосередньо in vivo (наприклад, внутрішньовенна ін'єкція, доступну пухлина, в легені за допомогою аерозолю, в судинну систему, викона�акових утворень, пухлин і хвороб, які випливають з небажаної проліферації клітин. Можливі застосування, які можуть бути згадані, включають ракові утворення молочної залози, матки (в особливості, викликані вірусами папіломи), передміхурової залози, легенів, сечового міхура, печінки, кишечника, підшлункової залози, шлунка, стравоходу, гортані, центральної нервової системи (наприклад, глиобластома) і крові (лімфоми, лейкемія тощо). Інше переважне використання полягає в лікуванні або запобігання ревматоїдного артриту, остеопорозу та інших хвороб, пов'язаних з підвищеною активністю остеокластів. Вона може також використовуватися в контексті серцево-судинних хвороб, наприклад, для інгібування або затримку проліферації клітин гладких м'язів стінки кровоносної судини (рестеноз). Нарешті, у випадку інфекційних хвороб, можливо застосовувати лікарський засіб при Сніді.

Коли поксвирус, композиція, або спосіб винаходи використовуються для лікування раку, кращий шлях введення являє собою системний шлях, так як поксвирус згідно винаходу в стані специфічно націлюватися на пухлинні клітини.

Винахід також охоплює метод для лечен господаря або клітку, яка потребує такого лікування.

Згідно вигідним варіантом втілення терапевтичне використання або спосіб лікування також включає додаткову стадію, в якій фармацевтично прийнятні кількості проліки, переважно аналога цитозина, особливо 5-FC, вводять в організм господаря або клітку. За допомогою ілюстрації можливо використовувати дозу від 50 до 500 мг/кг/добу, при цьому необхідна доза 200 мг/кг/ добу або 100 мг/кг/добу. У межах контексту цього винаходу проліки вводять у відповідності зі стандартною практикою (наприклад, перорально, систематично).

Бажано введення, що відбувається після введення поксвируса або композиції згідно з винаходом, переважно принаймні через 3 дні, більш переважно принаймні 4 дні і ще більш переважно принаймні 5 днів, після введення поксвируса або композиції у відповідності з винаходом. Відповідно до навіть кращим варіантом втілення даного винаходу введення проліки має місце через 7 днів після введення терапевтичного агента. Кращий пероральний шлях. Можливо вводити одноразову дозу проліки або �іта в межах організму господаря або клітини.

Крім того, композиція, або спосіб згідно винаходу можуть бути комбіновані з одним або декількома речовинами, які потенциируют цитотоксичний ефект 5-FU. Особливо можна згадати лікарські препарати, які інгібують ферменти шляхи для біосинтезу de novo піримідинів (наприклад, згадані нижче), лікарські препарати, такі як лейковорин (Waxman et al., 1982, Eur. J. Cancer Clin. Oncol. 18, 685-692), який, у присутності продукту метаболізму 5-FU (5-FdUMP), збільшує інгібування тимидилатсинтази, приводячи до зменшення пулу dTMP, який вимагається для реплікації, і нарешті, лікарські препарати, такі як метотрексат (Cadman et al., 1979, Science 250, 1135-1137), який, інгібуючи дигидрофолатредуктазу і збільшуючи пул PRPP (фосфорибозилпирофосфат), викликає збільшення впровадження 5-FU в клітинну РНК. Згідно з цим винаходу лікарські препарати, які інгібують ферменти шляхи для біосинтезу de novo піримідинів, переважно вибирають із групи, що складається з PALA (N-(фосфоноацетил)-L-аспартату; Moore et al., 1982, Biochem. Pharmacol. 31, 3317-3321), лефлуномида, A771726 (активний метаболіт лефлуномида; Davis et al., 1996, Biochem. 35, 1270-1273) і бреквинара (Chen et al., 1992, Cancer Res. 52, 3251-3257).

Композиція, або спосіб у відповідності з винаходом мо�ацевтических речовин, ефективних протиракової терапії, які можуть використовуватися в асоціації або в комбінації з композиціями згідно винаходу, можна згадати алкілуючі агенти, такі як, наприклад, мітоміцин С, циклофосфамід, бусульфан, ифосфамид, изосфамид, мелфалан, гексаметилмеламин, тіотепа, хлорамбуцил або дакарбазин; антиметаболіти, такі як, наприклад, гемцитабін, капецитабін, 5-фтороурацил, цитарабін, 2-фтордезоксицитидин, метотрексат, идатрексат, томудекс або триметрексат; інгібітори топоізомеразу II, такі як, наприклад, доксорубіцин, епірубіцин, етопозид, теніпозід або мітоксантрон; інгібітори топоізомеразу I, такі як, наприклад, іринотекан (СРТ-11), 7-етил-10-гідрокси-камптотецин (SN-38) або топотекан; антимитотические препарати, такі як, наприклад, паклитаксель, доцетаксель, вінбластин, вінкристин або винорелбин; і похідні платини, такі як, наприклад, цисплатин, оксаліплатин, спироплатин або карбоплатин. Композиції або способи згідно з винаходом можуть також бути використані в комбінації з променевою терапією.

Композиції або способи згідно з винаходом можуть також бути використані в комбінації з одним або кількома іншими агентами, включаючи, крім нности, IL-2, IL-6, IL-10 або IL-12) або фактор некрозу пухлини; агенти, які впливають на регулювання рецепторів клітинної поверхні, такі як, наприклад, інгібітори рецептора епідермального фактора росту (особливо, цетуксимаб, панитумумаб, залутумумаб, нимотузумаб, матузумаб, гефитиниб, эрлотиниб або лапатініб) або інгібітори рецептора людського епідермального фактора росту 2 (в особливості, транстузумаб); і агенти, які впливають на ангіогенез, такі як, наприклад, інгібітор судинного ендотеліального фактора росту (особливо, бевацізумаб або ранибизумаб).

Короткий опис Фігур в кресленнях

Фігура 1. Чутливість in vitro до 5-FC з інфікованих вірусом осповакцини людських клітин колоректальної пухлини (LoVo). Клітини LoVo, інфіковані при MOI 0,0001 зазначеними вірусами (приклад () VVTK-/FCU1 () або VVTK-F2L-/FCU1 (), піддають дії різної концентрації 5-FC. Виживання клітин визначають через 5 днів після інфікування. Результати виражають у відсотках клітинної життєздатності в присутності або відсутність лікарських препаратів. Значення представляють у вигляді середнього значення ± SD трьох індивідуальні�n vitro в LoVo, інфікованих при MOI 0,0001 зазначеними вірусами в день 5 після інфікування. Значення представляють у вигляді середнього значення ± SD трьох індивідуальних визначень.

Постать 3. Середній об'єм пухлини ± SEM п/к LoVo у швейцарських голих мишей після в/в ін'єкції вірусу. Через 7 днів після інокуляції пухлини (пальпована пухлина), мишей лікують за допомогою 107pfu буфера + сольовий розчин (), буфер + 5-FC (), VVTK-F2L-/FCU1 + сольовий розчин () або VVTK-F2L-/FCU1 + 5-FC (). Тварин лікують сольовим розчином або 5-FC при 100 мг/кг/j два рази в день чреззондовим годуванням, через 7 днів після вірусної ін'єкції протягом 3 тижнів. Два рази в тиждень визначають обсяг пухлини.

Фігура 4. Середній об'єм пухлини ± SEM п/к HepG2 пухлин у швейцарських голих мишей після в/в ін'єкції вірусу. Через 14 днів після інокуляції пухлин (пальпована пухлина), мишей лікують за допомогою 107pfu буфера + вода (), або буфер + 5-FC (), або 106pfu VVTK-/FCU1 + вода (), або 106pfu VVTK-/FCU1 + 5-FC () (А); або буфер + вода (), або буфер + 5-FC () (). Тварин лікують 5-FC при 100 мг/кг два рази на день чреззондовим годуванням, через 7 днів після вірусної ін'єкції та протягом 3 тижнів. Два рази в тиждень визначають обсяг пухлини.

Постать 5. Співвідношення виходу вірусу у діляться клітинах у порівнянні зі зливаються клітинами. Клітини PANC1 (пухлина підшлункової залози людини), H1299 (пухлина легенів людини) або U118MG (пухлина гліоми людини) інфікують з допомогою 100 pfu () VVTK-/FCU1 або () VVTK-F2L-/FCU1. Через 48 годин після інфікування визначають вірусні титри. Значення являють собою співвідношення між виходами вірусу діляться клітинах у порівнянні зі зливаються клітинами.

Фігура 6. Вірусні титри (pfu/мг тканини) в органах або пухлинах в день 6 і 21 день після в/в інфекції у швейцарських голих мишей, що носять підшкірні людські пухлини з 1×106PFU VVTK-/FCU1 () або VVTK-F2L-/FCU1 ().

Фігура 7. Виживання швейцарських голих мишей після лікування з допомогою 1×108pfu VVTK-/FCU1 () або VVTK-F2L-/FCU1 () шляхом в/в ін'єкції.

Фігура 8. Виживання імунокомпетентних мишей B6D2 після лікування з допомогою 1×107pfu (А) або p>

Фігура 9. Середня кількість віспин на хвостах після в/в ін'єкції 1×106pfu VVTK-/FCU1 або VVTK-F2L-/FCU1 у швейцарських голих мишей в день 13 після інфікування і в день 34 після інфікування.

Фігура 10. Середня кількість віспин на хвостах після в/в ін'єкції 1×107pfu VVTK-/FCU1 або VVTK-F2L-/FCU1 у швейцарських голих мишей в 15-й день після інфікування і в день 31 після інфікування.

Спосіб(и) для здійснення винаходу

Приклади

Конструкція векторних плазмід

Будують човникову плазміду для видалення F2L з використанням ДНК штаму Copenhagen вірусу осповакцини (інвентарний номер М35027). Фланкуючі ділянки ДНК F2L амплифицируют за допомогою ПЛР. Праймери висхідного фланкирующего ділянки F2L являють собою 5' - CGCGGA ТССGAA AGC GAT GAA СТА ААТ GTT С - 3' (SEQ ID N°: 7; ділянка BamHI підкреслять), і

5' - ТССССС GGGGTT AGT ТТС CTT AAC AAA ТСТ ААС - 3' (SEQ ID N°: 8; ділянка SmaI підкреслять). Праймери спадного ділянки являють собою 5' - GCC TGG ССА АСА ААТ AGA GGA GAT САА GGG Т - 3' (SEQ ID N°: 9; ділянка MscI підкреслять), та 5' - GCCCTG CAGАСС ACT АСА ТСА ATT ТТА САА AAG - 3' (SEQ ID N°: 10; ділянка PvuII підкреслять). Амплифицированний фрагмент розщеплюють ДНК ферментом рестрикції SmaI/BamHI або MscI/PvuII і лигируют у відповідні ділянки в плазмиде PpolyIII. Повторювальними�CA TGC ТСС AGA ATT GAT CAT AGT GGA ТА - 3' (SEQ ID N°: 11; ділянка SphI підкреслять), та 5' - GCT СТА GAG ТТА GTT ТСС ТТА АСА ААТ СТА АС - 3' (SEQ ID N°: 12; ділянка XbaI підкреслять) і вставляють в плазміду PpolyIII. Повторний ділянку використовують для усунення касети селекції під час виробництва віддалених вірусів. Касету селекції, відповідну слитому гену GFP/GPT при контролі pH5R промотера осповакцини, вставляють в ділянку SmaI/SphI в плазмиде PpolyIII. Отримана плазміда являє собою рекомбинантную човникову плазміду під назвою pΔF2L для видалення гена F2L.

Отримання рекомбінантних вірусів осповакцини.

Клітини CEF інфікують штамом Copenhagen VVTK-FCU1 (вірус Vaccinia, дефектний на ген J2R, экспрессирующий ген FCUL під контролем синтетичного промотера p11k7.5) при MOI 0,1 і інкубують при 37°с протягом 2 год, потім трансфецируют з копреципитатом CaCl2рекомбінантної човникової плазміди (0,2 мкг). Клітини інкубують протягом 48 год при 37°C. Отримані розведення вірусу використовують, щоб інфікувати клітини CEF в селективному середовищі, що містить гіпоксантин при кінцевої концентрації 15 мкг/мл, ксантин при кінцевій концентрації 250 мкг/мл і микофеноловую кислоту при кінцевій концентрації 250 мкг/мл Флуоресцентні (GFP) і позитивні (GPT селекція) бляшки изолир�і відсутність VVTk-FCU1 визначають 40 циклами ПЛР з праймерами в ділянці делеції. Після усунення батьківського вірусу використовують подвійний віддалений вірус для інфікування CEF без селективної середовища GPT, щоб усунути касету селекції. Нефлуоресцентние бляшки ізолюють і відбирають для 2 циклів в CEF. Прикінцеві рекомбінантні віруси VV амплифицируют в CEF, очищають і вірусні вихідні розчини титрують на CEF з допомогою тесту на бляшки.

Клітинна чутливість in vitro до 5-FC

Людські клітини пухлини перетворюють відповідним рекомбінантним VV при MOI 0,0001. У загальній складності 3×105клітин/лунку поміщають на 6-лункові чашки для культури в 2 мл середовища, що містить різні концентрації 5-FC. Потім клітини культивують при 37°C протягом 5 днів і життєздатні клітини підраховують з допомогою винятку трипаном синім. Результати, зображені на фігурах 1, 2, показують, що активність FCU1 еквівалентна у вірусів, дефектних на ген J2R, ніж у вірусу, дефектного на ген J2R і F2L.

In vitro реплікація в культивованих клітинах

Діляться клітини або клітини зливаються інфікують в 6-лункових дисках при 100 PFU вірусів (майже MOI 0,0005). Додають 2 мл середовища з 10% FCS для клітин, що діляться, та без добавок для злиття клітин. Клітки збирають через 48 годин після інфікування. Клітини Ѹтрованием дисків на клітинах CEF. Співвідношення між реплікацією в діляться клітинах і зливаються клітинах подібно у всіх клітинах. Обидва вірусу VVTK-/FCU1 і VVTK-F2L-/FCU1 реплікуються більше діляться клітинах, ніж у зливаються клітинах.

Як непряме значення для кількісного визначення вірусної специфічності до реплікації, визначають вихід вірусу, отриманий діляться клітинах порівняно зі зливаються пухлинними клітинами (людська пухлина підшлункової залози PANC1; людська пухлина легені H1299; людська пухлина гліоми U118MG). Зливаються клітини поміщають на планшети при 1×106клітин/лунку і культивують в повних середовищах протягом 7 днів, потім за 1 день до інфікування клітини промивають і культивують на середовищі без сироватки. Діляться клітини поміщають на планшет при 3×105клітин/лунку на один день перед інфікуванням. Щоб оцінити рівень клітинного поділу, кількість оттитрованного тимидина, включеного в нуклеїнову кислоту, визначають через 5 годин, 24 години і 48 годин після культивування клітин на планшеті. Під час цього періоду включення тимидина є відносно постійним у зливаються клітинах, тоді як діляться клітинах збільшення включення помічають з часом. Тоді �са, виробленого в діляться пухлинних клітинах і зливаються в пухлинних клітинах, визначають титруванням дисків на CEF. Результати, зображені на малюнку 5, показують, що обидва вірусу VVTK-/FCU1 і VVTK-F2L-/FCU1 більше реплікуються в діляться клітинах, ніж у зливаються клітинах.

Підшкірна модель пухлини

Самок швейцарських голих мишей отримують з Charles River Laboratories. Тварини, що використовуються в дослідженнях, є однорідними за віком (6 тижнів), а маси тіла коливаються від 20 до 23 р. Швейцарським голим мишам вводять підшкірно (п/к) в бік 5×106клітин LoVo/100 мкл. Коли пухлини досягають діаметра 50-70 мм3, мишей рандомизируют довільним способом і обробляють зазначеними векторами для експериментів in vivo.

Биораспределение вірусу.

Присутність VV-FCU1 і VVTK-F2L-/FCU1 оцінюють вірусним титруванням в зразках органів і пухлин. 1×106вірусів вводять внутрішньовенно (в/в) ін'єкцією в хвостову вену голим мишам з заданими п/к пухлинами LoVo. Мишей умертвляют на 14 день після інфікування і пухлини та інші органи збирають і зважують. Пухлини і органи гомогенізують в PBS і титри визначають на CEF, як описано раніше. Вірусні титри стандартизують до миллиграмму тканини. Вірусні титри стандарти/мг тканини), показують, що після 14 днів вірус згідно винаходу головним чином виявляється в пухлини. У другому наборі експериментів, у відповідності з тими ж умовами, як описано вище, мишей умертвляют на 6 день і 21 день після інфікування. Результати, зображені на малюнку 6, показують, що обидва вірусу VVTK-/FCU1 і VVTK-F2L-/FCU1 націлюються на пухлину приблизно в 1000-10000 разів більше вірусу в пухлини, ніж в інших органах, проаналізованих за винятком хвостів у разі VVTK-/FCU1. Невелика кількість VVTK-/FCU1 виявлено в легенях, селезінці, нирках і лімфовузлах (менше ніж 10 pfu/мг) і більше в шкірі, хвості і кістковому мозку в 6 день, і шкірі і хвості у день 21. Навпаки, VVTK-F2L-/FCU1 має більш високу специфічність до пухлини з невеликою кількістю в легенях, селезінці, нирках, лімфовузлах і шкірі в 6 день, і в шкірі і хвості у день 21.

"justify">0-1,8
Таблиця 2
ПухлинаЛегкіСелезінкаНиркаСерцеЛімфовузли
VVTK-/FCU10-0,30-61
VVTK-F2L/FCU10-8,1×1040-5,70-9,30,2-30,20-83

<�новленними п/к пухлинами LoVo (50-70 мм3) отримують лікування один раз внутрішньопухлинно або два рази внутрішньовенно (хвостова вена) зазначеними векторами в дозі 1.104PFU, 1.106PFU або 1.107PFU відповідно. Починаючи з дня 7 після вірусної ін'єкції, 5-FC вводиться перорально через зонд при 100 мг/кг (0,5 мл 5-FC 0,5% у воді) два рази на день протягом 3 тижнів. Розмір пухлини визначають двічі на тиждень з використанням кронциркуля. Обсяг пухлини вираховують мм3з використанням формули (p/6) (довжина × ширина2). Результати, зображені на малюнку 3, показують, що у 2 вірусів є подібна ефективність з онколитической активністю (p < 0,05), здатна контролювати ріст пухлини, і об'єднана активність (онколитическая вірусу і терапевтична гена FCU1) з введенням 5-FC, який може додатково поліпшити контроль росту пухлини (p < 0,01). Голі миші з встановленими п/к пухлинами HepG2 (клітини гепатоцелюлярної печінкової карциноми людини) отримують лікування внутрішньовенно (хвостова вена) зазначеними векторами в дозі 1.106PFU у відповідності з наступною схемою: через 14 днів після інокуляції пухлини (пальпована пухлина) мишей лікують: буфер + вода, або буфер + 5-FC, або 106pfu VVTK-/FCU1 + вода, або 106pfu VVTK-/FCU1 + 5-FC, або 106ально через зонд, через 7 днів після вірусної ін'єкції та протягом 3 тижнів. Розмір пухлини визначають двічі на тиждень з використанням кронциркуля. Обсяг пухлини вираховують мм3з використанням формули (π/6) (довжина × ширина2). Результати, зображені на малюнку 4. показують контроль над розвитком пухлини після ін'єкції VVTK-/FCU1 і VVTK-F2L-/FCU1 (p < 0,0001) щодо буфера. Активність не збільшується після введення 5-FC. Самостійна онколитическая активність вірусу є дуже сильною вже при ін'єкції вірусів в дозі 1×106PFU.

Вірусна патогенність

Вірусну патогенність оцінюють дослідженнями виживання, які проводять і на швейцарських голих мишей (фігура 7) і на імунокомпетентних мишах B6D2 ((6 тижнів від Charles Rivers) (фігура 8)). Мишам в/в вводять 1.107або 1.108PFU всіх вірусів в 100 мкл буфера на мишу. За мишами спостерігають щодня по ходу експерименту. У швейцарських голих мишей (фігура 7) ін'єкція 1×108PFU VVTK-/FCU1 призводить до смерті 40% тварин через 3 дні після інфікування. Залишаються миші вмирають між днем 50 і вдень 80 після інфікування. Введення VVTK-F2L-/FCU1 є менш патогенним, більшість тварин вмирає між днем 65 і 115 (p < 0,05). Не спостерігається ніяких свідоцтв �ечением VVTK-F2L-/FCU1 має значно більш тривале виживання до 92% (p<0,00005) порівняно з VVTK-/FCU1 інфікованими мишами. Тому цей результат демонструє зменшення токсичності з подвійним віддаленим вірусом VVTK-F2L-/FCU1.

Модель ураження хвоста оспою

Швейцарським голим мишам в/в вводять 1.106(Фігури 9) або 1.107(Фігури 10) PFU кожного вірусу. Ураження хвоста вираховують один раз в тиждень. У мишей, яким вводять 1.106PFU VVTK-F2L-/FCU1, зазначається менше ніж 1 віспини/миша порівняно з мишами, яким вводять VVTK-/FCU1 з середнім числом, рівним 8 віспин на мишу в день 13 після інфікування (p < 0,001), як показано на фігурі 9(А). Результати подібні у день 34 після інфікування з середнім числом, рівним 4 оспинам з VVTK-/FCU1 порівняно з майже 1 для VVTK-F2L-/FCU1 (p < 0,0001), як показано на фігурі 9(У). У мишей, яким вводять 1.107PFU VVTK-F2L-/FCU1, зазначається відповідно середнє число, рівне 3,5 віспин/миша і 2 віспини/миша порівняно з мишами, яким вводять 1.107PFU VVTK-/FCU1, що мають в середньому 10 віспин/миша в 15-й день після інфікування (фігура 10(А)). У день 31 після інфікування у мишей, яким вводять VVTK-F2L-/FCU1, зазначається відповідно в середньому 3,5 віспин/миша порівняно з мишами, яким вводять VVTK-/FCU1, що мають в середньому 7 віспин/миша (фігура 10(В)). Різниця в кількості віспин між VVTK-/FCU1 і VVTK-F2L-/FCU1 є статистично суѾксичностью. Ін'єкція в/в VVTK-F2L-/FCU1 є менш токсичним, ніж з одноразовим віддаленим вірусом ТК.

Статистичний аналіз

Проводять статистичні дослідження, використовуючи непараметрический U тест Mann-Whitney і програмне забезпечення STATISTICA 7.1 (StatSoft, Inc). Р<0,05, як вважають, є статистично істотною.

Посилання

- US 5364773 (VIROGENETICS CORPORATION (TROY, NY)) 15.11.1994

- WO 2004/014314 (KIRN DAVID (US)) 19.02.2004

- WO 2004/014314 (KIRN DAVID (US)) 19.02.2004

- US 5364773 (VIROGENETICS CORPORATION (TROY, NY)) 15.11.1994

- WO 93/01281 (US HEALTH)

- WO 2005/007857

- WO 2005/007857

- EP 0998568 A

- EP 0998568 A

- EP 0998568 A

- EP 0998568 A

- WO 96/16183

- EP 0998568 A

- EP 0998568 A

- WO 2006/048768

- HERMISTON. A demand for next-generation oncolytic adenoviruses. Current opinion in molecular therapeutics. 2006, vol.8, no.4, p.322-30.

- FISHER. Striking out at disseminated metastases: the delivery of systemic oncolytic viruses. Current opinion in molecular therapeutics. 2006, vol.8, no.4, p.301-13.

- CHERNAJOVSKY, et al. Fighting cancer with oncolytic viruses. British medical journal. 2006, vol.332, no.7534, p.170-2.

- JIANG et al. Oncolytic adenoviruses as antiglioma agents. Expert review of anticancer therapy. 2006, vol.6, no.5, p.697-708.

- COHEN et al. ONYX-015. Onyx Pharmaceuticals. Current opinion in investigational drugs. 2001, vol.2, no.12, p.1770-5.

- ROBERTS, et al. Naturally oncolytic viruses. Current opinion in molecular therapeutics. 2006, vol.8, no.4, p.314-21.

- THORNE, et al. Vaccinia virus and oncolytic virotherapy of cancer. Current opinion in molecular therapeutics. 2005, vol.7, no.4, p.359-65.

- STANFORD, et al. Myxoma virus and oncolytic virotherapy: a new biologic weapon in the war against cancer. Eity and mortality weekly report. Recommendations and reports / Centers for Disease Control. 2003, vol.52, no. RR-4, p.1-28.

- XIANGZHI, et al. Vaccinia virus K1L protein supports viral replication ant human and rabbit cells through a cell-type-specific set of its ankyrin repeat residues that are distinct from its binding site for ACAP2. Journal of virology. 2006, vol.353, no.1, p.220-233.

- MCCART, et al. Systemic cancer therapy with a tumor selective vaccinia virus mutant lacking thymidine kinase and vaccinia growth factor genes. Cancer res.. 2001, no.61, p.8751-57.

- KIM et al. Systemic armed oncolytic ans immunologic therapy for cancer with JX-594, a targeted poxvirus expressing GM-CSF. Molecular Therapeutic. 2006, no.14, p.361-70.

- SLABAUGH, et al. Journal of virology. 1988, vol.62, p.519-27.

- TENGELSEN, et al. Virology. 1988, no.164, p.121-31.

- SCHMITT, et al. Journal of virology. 1988, no.62, p.1889-97.

- SLABAUGH, et al. Journal of virology. 1984, no.52, p.507-14.

- SLABAUGH, et al. Journal of virology. 1984, no.52, p.501-6.

- HOWELL, et al. Journal of Biological Chemistry. 1992, no.267, p.1705-11.

- MCGEOGH. Nucleic Acids Research. 1990, no.18, p.4105-10.

- BROYLES. Virology. 1993, no.195, p.863-5.

- ANTOINE. Virology. 1998, no.244, p.365-396.

- EL OMARI, et al. Structure of vaccinia virus thymidine kinase in complex with dTTP insights for drug design. BMC structural biology. 2006, no.6, p.22.

- MCCART, et al. Systemic cancer therapy with a tumor-selective vaccinia virus mutant lacking thymidine kinase and vaccinia growth factor genes, cancer research. 2001, vol.61, no.24, p.8751-7.

- PUHLMANN, et al. Vaccinia as a vector for tumor-directed gene therapy: biodistribution of a thymidine kinase-deleted mutant. Cancer gene therapy. 2000, vol.7, no.l, p.66-73.

- GNANT, et al. Systemic administration of a recombinant vaccinia virus expressing the cytosine deaminase gene and subsequent treatment with 5-fluorocytosine leads to tumor-specific gene expression and prolongation of survival in mice. Cancer Research. 1999, vol.59, no.14, p.3396-403.

- JUND, et a12-18.

- ESDERS, et al. J. товарbiol. chem. 1985, no.260, p.3915-22.

- KOECHLIN, et al. Біохімічний pharmacology. 1966, no.15, p.435-46.

- POLAK, et al. Chemotherapy. 1976, no.22, p.137-53.

- JUND, et al. Journal of Bacteriology. 1970, no.102, p.607-15.

- KILLSTRUP, et al.. Journal of Bacteriology. 1989, no.171, p.2124-2127.

- HUBER, et al. Cancer Research. 1993, no.53, p.4619-4626.

- MULLEN, et al. Proceedings of the National Academy of Sciences of the United States of America. 1992, no.89, p.33-37.

- HUBER, et al. Proceedings of the National Academy of Sciences of the United States of America. 1994, no.91, p.8302-6.

- MESNIL, et al. Proceedings of the National Academy of Sciences of the United States of America. 1996, no.93, p.1831-35.

- ANDERSEN, et al. Characterization of the upp gene encoding uracil phosphoribosyltransferase of Escherichia coli K12. European Journal of Biochemistry. 1992, no.204, p.51-56.

- MARTINUSSEN, et al. Cloning and characterization of upp, a gene encoding uracil phosphoribosyltransferase from Lactococcus lactis. Journal of Bacteriology. 1994, vol.176, no.21, p.6457-63.

- KIM et al. Complete sequence of the UPP gene encoding uracil phosphoribosyltransferase from Mycobacterium bovis BCG. Biochemistry and molecular biology international. 1997, vol.41, no.6, p.1117-24.

- MARTINUSSEN, et al. Two genes encoding uracil phosphoribosyltransferase are present in Bacillus subtilis. Journal of Bacteriology. 1995, vol.177, no.1, p.271-4.

- KERN, et al. The FUR1 gene of Saccharomyces cerevisiae: cloning, structure and expression of wild-type and mutant alleles. Gene. 1990, vol.88, no.2, p.149-57.

- CHAKRABARTI.. Biotechniques. 1997, no.23, p.1094-97.

- HAMMOND, et al. Journal of Virological Methods. 1997, no.66, p.135-38.

- KUMAR. Virology. 1990, no.179, p.151-8.

1. Спосіб лікування проліферативних захворювань або захворювань з підвищеною активністю остеокластів, відрізняється тим, що поксвирус, включаѻичестве.

2. Спосіб за п. 1, де поксвирус додатково включає дефектний ген F2R.

3. Спосіб за п. 1 або 2, де проліферативним захворюванням є рак або рестеноз.

4. Спосіб за п. 1 або 2, де захворюванням, пов'язаним з підвищеною активністю остеокластів, є ревматоїдний артрит або остеопороз.

5. Спосіб за п. 1 або 2, де зазначений поксвирус належить до підродини Chordopoxvirinae.

6. Спосіб за п. 5, де зазначений поксвирус належить до виду Vaccinia virus.

7. Спосіб за п. 6, де зазначений поксвирус належить до штаму Copenhagen Vaccinia virus.

8. Спосіб за п. 6, де зазначений поксвирус належить до штаму WR Vaccinia virus.

9. Спосіб за п. 1, де зазначений поксвирус додатково включає суициидальний ген.

10. Спосіб за п. 9, в якому зазначений суїцидальний ген кодує білок, що має принаймні активність цитозиндезаминази.

11. Спосіб за п. 9, в якому зазначений суїцидальний ген кодує білок, що має принаймні активність урацилфосфорибозилтрансферази.

12. Спосіб за п. 10, в якому зазначений суїцидальний ген являє собою FCY1, FCA1 або CodA або їх аналог.

13. Спосіб за п. 10, в якому зазначений білок, що має принаймні активність цитозиндезаминази, є поліпептидом �тором зазначений суїцидальний ген кодує білок, має принаймні одну активність цитозиндезаминази і одну урацилфосфорибозилтрансферази.

15. Спосіб за п. 14, в якому зазначений суїцидальний ген кодує поліпептид, що включає аминокислотную послідовність практично таку ж, як представлена в ідентифікаторі послідовності SEQ ID N°:3 (coda::upp), SEQ ID N°:1 (FCU1), або аминокислотную послідовність FCY1::FUR1.

16. Спосіб за п. 1, в якому зазначений поксвирус додатково включає нуклеиновокислотную послідовність, що включає ген, що кодує пермеазу.

17. Спосіб за п. 16, в якому пермеаза є пурин - або цитозинпермеазой S. Cerevisiae.

18. Спосіб за п. 17, в якому пермеазу вибирають із групи, що включає FCY2 і Fur4 та їх аналоги.

19. Спосіб за пп. 9-13 і 15, в якому зазначений поксвирус додатково включає елементи, необхідні для експресії суицидного гена.

20. Спосіб за пп. 16-18, в якому зазначений поксвирус додатково включає елементи, необхідні для експресії пермеази.

21. Спосіб за будь-яким із пп. 1, 2, 6-13 та 15-18, в якому зазначений поксвирус або композицію вводять системним шляхом.

22. Спосіб за будь-яким із пп. 1, 2, 6-13 та 15-18, що включає додаткову стадію, в якій фармацевтично прийнятні кількісних�ного проліки проводять переважно через принаймні 3 дні після введення поксвируса.

24. Спосіб за п. 23, в якому введення зазначеного проліки проводять через 7 днів після введення поксвируса.

25. Спосіб за будь-яким із пп. 1, 2, 6-13 та 15-18, де поксвирус вводять в комбінації з одним або декількома речовинами, які потенциируют цитотоксичний ефект 5-фторцитозина.

26. Спосіб за п. 25, в якому зазначені речовини, потенциирующие цитотоксичний ефект 5-фторцитозина, являють собою лікарські препарати, які інгібують ферменти шляхи для біосинтезу de novo піримідинів, переважно вибраних з групи, що складається з PALA, лефлуномида і А 771726.

27. Спосіб за п. 25, в якій вказана речовина, потенциирующее цитотоксичний ефект 5-фторцитозина, являє собою метотрексат.

28. Застосування поксвируса, як зазначено в будь-якому з пп. 1-21, для отримання препарату лікарського засобу для лікування проліферативних захворювань або захворювань з підвищеною активністю остеокластів.



 

Схожі патенти:

Спосіб отримання препаративних кількостей вірусних частинок флоэмно-органиченних вірусів

Винахід відноситься до біотехнології та фундаментальної вірусології. Запропоновано спосіб отримання препаративних кількостей вірусних частинок, що імітують віріони вірусу скручування листя картоплі (ВСЛК). Спосіб передбачає отримання химерного вірусу шляхом вставки гена білка оболонки икосаэдрического низкокопийного флоэмно-обмеженого вірусу (ИНФОВ) в ефективний вірусний вектор на основі РНК тобамовируса. Далі проводять зараження рослини отриманим химерним вірусом для розмноження та його накопичення в тканинах рослин. У висновку проводять виділення химерного вірусу з тканин рослини. Також описані плазміда для здійснення такого способу, препарат химерного вірусу, одержуваного з допомогою описаного способу, спосіб отримання антисироватки до природних изолятам ВСЛК та її використання. Винахід може бути використано в галузі сільського господарства. 7 н. і 3 з.п. ф-ли, 12 іл.

Ліофілізована композиція для індукції імунної відповіді на флавивирус, композиція та спосіб її отримання

Представлені винаходи належать до ліофілізованої композиції для індукції імунної відповіді на флавивирус, композиції для отримання зазначеної ліофілізованої композиції і способу отримання ліофілізованої композиції. Охарактеризована ліофілізована композиція містить ефективне кількість живої ослабленої флавивируса, один або кілька стабілізаторів, один або кілька буферних компонентів, лактозу і аморфний маніт, яка отримана лиофилизацией суміші, що містить ефективне кількість живої ослабленої флавивируса, один або кілька стабілізаторів, один або кілька буферних компонентів, лактозу і манить, причому флавивирус може бути химерним флавивирусом. При отриманні зазначеної ліофілізованої композиції проводять заморозку компонентів з подальшим їх сушінням. Винаходи дозволяють отримувати стійкі при транспортуванні і зберіганні композиції, що включають флавивирус. 3 н. і 28 з.п. ф-ли, 13 іл., 10 табл., 2 пр.

Флавивирус з двокомпонентним геномом і його використання

Винахід відноситься до галузі біотехнології, вірусології та медицини. Запропонована комбінація флавивирусних частинок. Перша флавивирусная частка містить псевдоинфицирующий вірусний геном, що кодує цис-активні промоторние елементи, необхідні для реплікації РНК, білки оболонки і повний набір неструктурних білків флавивируса; і не кодує капсидние білки флавивируса. Друга флавивирусная частка містить комплементарний геном, що кодує цис-активні промоторние елементи, необхідні для реплікації РНК, капсидний білок і повний набір неструктурних білків флавивируса; і не кодує білки оболонки флавивируса. Оскільки генетичний матеріал флавивируса розподілений між двома геномами, флавивирус є дефіцитним по реплікації і не здатний викликати захворювання, але здатний індукувати імунну відповідь. Також описаний спосіб одержання такої комбінації, фармацевтична композиція та спосіб її застосування. Винахід може бути використаний в медицині. 5 н. і 8 з.п. ф-ли, 18 іл., 14 пр.

Кодон-оптимізована кднк, що кодує дисферлин людини, генно-інженерна конструкція, рекомбінантний аденовірус і фармацевтична композиція для лікування дисферлинопатий

Винахід відноситься до галузі біотехнології і стосується кДНК, що кодує дисферлин людини, генно-інженерної конструкції, в яку клонована така кДНК, рекомбінантного аденовірусу і фармацевтичної композиції. Описана генно-інженерна конструкція містить экспрессионний плазмідний аденовірусний вектор pAd/CMV/V5-DEST, який клонована за сайтів для рекомбінації attB1 і attB2 кодон-оптимізована кДНК, має послідовність, представлену в SEQ ID NO: 1 і кодує дисферлин людини. Рекомбинатний репликационно дефектний аденовірус серотипу 5 отримують із застосуванням такої генно-інженерної конструкції і включають в фармацевтичну композицію в ефективному кількості. Винаходи дозволяють відновити порушену експресію і/або функцію білка дисферлина в скелетної поперечно-смугастої м'язової тканини і викликати стабільний позитивний ефект. 4 н.п. ф-ли, 2 іл.

Рекомбінантна псевдоаденовирусная частка на основі геному аденовірусу людини 5 серотипу, яка продукує гемаглютинін вірусу грипу штаму a/brisbane/59/2007(h1n1) і спосіб її використання

Винахід відноситься до галузі біотехнології і стосується рекомбінантних векторів, використовуваних для виробництва протигрипозних вакцин. Охарактеризовано рекомбінантна псевдоаденовирусная частка на основі геному аденовірусу людини 5 серотипу та спосіб її використання. Представлена частка містить экспрессирующую касету зі вставкою гена гемаглютиніну вірусу грипу, при цьому в якості гена гемаглютиніну вірусу грипу було використано ген гемаглютиніну штаму A/Brisbane/59/2007(H1N1) з попередньо оптимізованої для експресії в клітинах людини нуклеотидної послідовністю, представленої в SEQ ID N0:2. Зазначений ген гемаглютиніну вірусу грипу клоновано в экспрессирующую касету, що містить сигнал полиаденилирования SV40 під контролем промотору цитомегаловірусу. Представлене винахід може бути використано для індукції специфічного імунітету до вірусу грипу А субтипу H1 і Н5 при введенні індивідууму в ефективному кількості, шляхом забезпечення посиленої експресії рекомбінантного гемаглютиніну вірусу грипу A/Brisbane/59/2007(H1N1). 2 н. і 4 з.п. ф-ли, 9 іл., 1 табл., 4 пр.

Самоинактивирующиеся аденовіруси-помічники для отримання рекомбінантних аденовірусів з високою ємністю

Винахід відноситься до галузі біотехнології. Запропоновано аденовірусний вектор-помічник для отримання рекомбінантного аденовірусу з високою ємністю. Зазначені вектора дозволяють розробляти системи для створення в клітинах рекомбінантних аденовірусів з високою ємністю, і які оптимально зменшують забруднення зазначених аденовірусів з високою ємністю аденовірусами-помічниками. Винахід може бути використано в клітинної технології. 8 н. і 20 з.п.ф-ли, 14 іл., 5 пр.

Засіб для нейтралізації вірусу натуральної віспи

Винахід відноситься до імунології та медицині і являє собою засіб для нейтралізації вірусу натуральної віспи, що представляє собою штучне одноцепочечное антитіло людини 1A, має аминокислотную послідовність, наведену в матеріалах заявки, экспонированное на поверхні нитчатого бактеріофага М13. Винахід дозволяє нейтралізувати вірус натуральної віспи. 7 іл., 4 пр.

Химерний цирковірус pcv2gen-1rep свиней та його застосування

Винахід відноситься до галузі біотехнології. Описана молекула химерної нуклеїнової кислоти цирковируса свиней (PCV2Gen-1Rep), яка включає молекулу нуклеїнової кислоти, що кодує цирковірус свиней 2 типу (PCV2), яка містить послідовність нуклеїнової кислоти, що кодує білок Rep цирковируса свиней 1 типу (PCV1). Химерну молекулу нуклеїнової кислоти конструюють допомогою заміщення гену Rep ORF1 PCV2 геном Rep ORF1 PCV1. Винахід також включає біологічно функціональну плазміду або вірусний вектор, що містять унікальні молекули химерних нуклеїнових кислот, відповідні клітини-господарі, трансфицированние плазміди або вектором, інфекційні химерні цирковируси свиней, які продукують відповідні клітини-господарі, спосіб отримання імуногенного поліпептидного продукту з використанням нової химери, вірусних вакцин, які захищають свиню від вірусної інфекції або синдрома мультисистемного послеотъемного виснаження (PMWS), викликаного PCV2, способи захисту свині від вірусної інфекції або синдрома мультисистемного послеотъемного виснаження (PMWS), викликаного PCV2, способи отримання унікальної химери PCV2Gen-1Rep і подібних. Винахід додатково включає новий спосіб збільшення у�п. ф-ли, 2 іл., 6 пр.

Поксвирусние онколитические вектори

Винахід відноситься до галузі біотехнології, вірусології та медицини. Запропоновано поксвирус осповакцини, який містить дефектний F2L ген і суїцидальний ген. Поксвирус має онколитической активністю. Запропоновано також спосіб відтворення такого поксвируса і його застосування для лікування проліферативних захворювань або захворювань з підвищеною активністю остеокластів. Винахід може бути використаний в медицині. 6 н. і 25 з.п. ф-ли, 10 іл., 3 табл.

Рекомбінантна псевдоаденовирусная частка на основі геному аденовірусу людини 5 серотипу, яка продукує гемаглютинін вірусу грипу штаму b/brisbane/60/2008, спосіб її використання для індукції специфічного імунітету до вірусу грипу в

Винахід відноситься до галузі біотехнології. Створена рекомбінантна псевдоаденовирусная частка на основі геному аденовірусу людини 5 серотипу, що містить экспрессирующую касету зі вставкою гена гемаглютиніну вірусу грипу. В якості гена гемаглютиніну вірусу грипу штаму B/Brisbane/60/2008 був використаний ген гемаглютиніну з попередньо оптимізованої для експресії в клітинах людини нуклеотидної послідовністю, з забезпеченням підвищеної експресії гена гемаглютиніну вірусу грипу штаму B/Brisbane/60/2008. Ген гемаглютиніну вірусу грипу штаму B/Brisbane/60/2008 з оптимізованою нуклеотидної послідовністю клоновано в экспрессирующую касету під контролем промотора і містить сигнал полиаденилирования, причому промотором є промотор цитомегаловірусу, а сигналом полиаденилирования є SV40. Экспрессирующая касета розташована в області делеції Е1 геному аденовірусу людини 5 серотипу. Також розкрито спосіб використання рекомбінантної псевдоаденовирусной частинки на основі геному аденовірусу людини 5 серотипу для індукції специфічного імунітету до вірусу грипу Ст. Винахід може бути використано в фармацевтичній промисловості для.

Способи одержання та очищення гетероарильних сполук

Винахід відноситься до способів одержання гетероарильних сполук, поданих структурними формулами (I) або (II): де R1-R4 мають значення, вказані в пп.1,14 формули. Зазначені сполуки можна використовувати для лікування або профілактики раку, запальних станів, імунологічних станів і т. д. 8 н. і 20 з.п. ф-ли, 20 пр.

Сіль конденсованого гетероциклічного похідного і його кристали

Винахід відноситься до нової холиновой солі 3-[2-фтор-5-(2,3-дифтор-6-метоксибензилокси)-4-метоксифенил]-2,4-діоксо-1,2,3,4-тетрагидротиено[3,4-d]піримідин-5-карбонової кислоти, що відповідає формулі (А) і до її кристалічній формі. . Кристалічна форма солі (А) має характерні піки при кутах дифракції (2θ(Å)) 7,1, 11,5, 19,4, 20,3, 21,5, 22,0, 22,6, 23,5 і 26,2 в діаграмі порошкової дифракції рентгенівських променів; характерні піки значень хімічних зрушень (δ(ppm)) 155,8, 149,8, 145,3, 118,0, 113,7, 111,6, 110,3, 98,1, 69,8, 58,7, 57,1 і 55,5 в твердотільному спектрі ЯМР 13С та характерні піки значень хімічних зрушень (δ(ppm)) -131,6, -145, і -151,8 в спектрі ЯМР 19F в твердій фазі, а також ендотермічний пік близько 213°С в діаграмі диференціально-термічного аналізу. З'єднання має гарну розчинність і стабільність при зберіганні. 4 з.п. ф-ли, 5 іл., 3 табл., 8 пр.

Модифіковані убиквитиновие білки зі специфічною зв'язує активністю для экстрадомена

Винахід відноситься до галузі біотехнології, конкретно до нових гетеромультимерним білків, отриманих з модифікованого убіквітину, і може бути використане в медицині для лікування або діагностики захворювань, асоційованих з гіперпродукцією экстрадомена В фібронектину (ED-B). Білок включає два мономерних убиквитинових ланки, по-різному модифікованих шляхом заміщень щонайменше 6 амінокислот у положеннях 4, 6, 8, 62, 63, 64, 65 і 66 SEQ ID NO: 1. При цьому в 1-му мономерном ланці заміщення включають: F4W, K6(Н,W, F), Q62N, Е64(K,R або Н), S65(L,F або W), Т66(S або Р), а в 2-му мономерном ланці: K6(Т,N,S або Q), L8(Q,t,N або S), Q62(W, F), K63(S,t,N або Q), Е64(N, S, Т або Q), S65(F або W), Т66(Е або D). Винахід дозволяє отримати модифікований гетеродимерний білок убіквітину, здатний зв'язувати ED-B з високою спорідненістю. 20 н. і 8 з.п. ф-ли, 18 іл., 3 табл., 7 пр.

Пептиди, які проникають у клітини, і їх застосування

Винахід відноситься до галузі біотехнології, конкретно до інтерналізації терапевтичних молекул всередину клітини, і може бути використане в медицині. Отримують композицію для доставки молекул нуклеїнових кислот в клітини, що містить щонайменше один пептид з щонайменше 92% ідентичністю до GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); або YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), приєднаний до однієї або кількох молекул нуклеїнових кислот. Винахід дозволяє підвищити ефективність доставки молекул нуклеїнових кислот всередину клітини ссавця за рахунок пептиду, здатного интернализироваться всередину клітини ссавця з ефективністю, що становить щонайменше 200% від ефективності інтерналізації пептиду ТАТ, має аминокислотную послідовність GRKKRRQRRRPPQ (SEQ ID NO: 1). 5 н. і 3 з.п. ф-ли, 16 іл., 1 табл., 8 пр.

Очищені пирролохинолинил-піролідин-2,5-дионовие композиції і способи їх отримання і застосування

Винахід відноситься до галузі органічної хімії, а саме до полиморфам форми 1 та форми 2 (-)-транс-3-(5,6-дигідро-4H-пирроло[3,2,1-ij]хинолин-l-іл)-4-(1H-індол-3-іл)піролідин-2,5-діон. Винахід відноситься до способів одержання зазначених полиморфов і фармацевтичної композиції на їх основі. Технічний результат: отримані нові полиморфи (-)-транс-3-(5,6-дигідро-4H-пирроло[3,2,1-ij]хинолин-l-іл)-4-(1H-індол-3-іл)піролідин-2,5-діон, корисні при лікуванні раку. 10 н. і 13 з.п. ф-ли, 26 іл., 2 табл., 27 пр.

Профілактична протиракова вакцина

Даний винахід відноситься до біотехнології і являє собою імуногенну композицію для попередження і лікування ракових захворювань, яка містить нефункціональний BORIS білок, в послідовності якого відсутні всі «цинкові пальці». Справжній винахід також розкриває иммунотерапевтическую композицію проти раку, що містить зазначений нефункціональний BORIS білок або клітину бактерії, ссавця або дріжджів або вірусну частинку, здатну до експресії зазначеного нефункціонального BORIS білка. Даний винахід розкриває також спосіб імунізації пацієнта шляхом запровадження ефективного кількості зазначеної иммунотерапевтической композиції, а також застосування зазначеної иммунотерапевтической композиції для приготування вакцини проти раку. Винахід дозволяє підвищити ефективність профілактичної і терапевтичної вакцини проти раку. 4 н. і 18 з.п. ф-ли, 7 іл., 2 табл., 8 пр.

Похідні имидазолидин-2,4-діон, що володіють активністю антипролиферативной

Винахід відноситься до галузі органічної хімії, а саме до нових гетероциклическим з'єднань загальної формули (I) або до його фармацевтично прийнятним солей, де R1 позначає ціано, нітро, аміно, -NHCOOR4 або-NHCOR4; R2 позначає галоген, C1-алкіл, галогенС1-алкіл або C1-алкокси; R3 позначає C1-алкіл; або обидва радикала R3 утворюють разом з атомом вуглецю, з якими вони пов'язані, циклоалкіл, що містить 3 члени; X позначає або алкіленовую ланцюжок з 4-7 атомів вуглецю, лінійну або розгалужену, причому цей ланцюжок може містити один або декілька однакових або різних додаткових ланок, вибраних з-O-, -N(R5)-; або групу де n1 і p1 позначають два цілих числа, сума яких n1+p1 є цілим числом, вибраним з 2; R6 та R7 разом утворюють ковалентную зв'язок або R6 та R7 утворюють разом з атомами вуглецю, з якими вони пов'язані, цикл або циклоалкіл, що містить 3 члени; R4 позначає C1-алкіл; R5 позначає C1-алкіл. Винахід відноситься до конкретних сполук, фармацевтичної композиції на основі сполуки формули (I), застосування формули сполуки (I). Технічний результат: одержано нові гетероциклічні сполуки, корисні при лікуванні раку. 5 н. і 18 з.п. ф-ли, 10 іл., 23 пр.

Комбінація джерела лейцину і джерела омега-3 ненасиченої жирної кислоти для лікування гіперкальціємії

Винахід відноситься до фармацевтичної промисловості і являє собою комбінацію джерела лейцину і джерела ω-3 полиненасищенной жирної кислоти для застосування при терапевтичному або профілактичному лікуванні гіперкальціємії. Винахід забезпечує розширення арсеналу засобів, застосовуваних при терапевтичному або профілактичному лікуванні гіперкальціємії. 2 н. і 17 з.п. ф-ли, 8 іл., 2 табл., 4 пр.

Імунобіологічний засіб для лікування раку сечового міхура і спосіб його використання

Група винаходів відноситься до медицини і стосується імунобіологічного засобу для лікування раку сечового міхура на основі вакцини БЦЖ, що включає фрагмент пептидоглікану, що містить у своїй структурі диаминопимелиновую кислоту. Група винаходів також стосується способу використання зазначеного імунобіологічного засобу для лікування раку сечового міхура. Група винаходів забезпечує збільшену протипухлинну активність. 2 н. і 3 з.п. ф-ли, 5 пр., 5 іл., 4 табл.

Інгібітори axl для застосування в комбінованій терапії для запобігання, усунення або лікування метастатичного раку

Винахід відноситься до медицини і призначене для запобігання, лікування або управління рак, переважно метастатичним раком, у пацієнта. Вводять ефективне кількість інгібітора Axl в поєднанні з введенням ефективного кількості одного чи більш ніж одного хіміотерапевтичного речовини. Інгібітор Axl являє собою 1-(6,7-дигідро-5Н-бензо[6,7]циклогепта[1,2-с]пірідазін-3-іл)-N3-(7-(піролідин-1-іл)-6,7,8,9-тетрагидро-5Н-бензо[7]аннулен-2-іл)-1H-1,2,4-триазол-3,5-діамін у вигляді виділеного стереоизомера або їх суміші, або у вигляді таутомера або їх суміші, або його фармацевтично прийнятну сіль або N-оксид. Хіміотерапевтичне речовина вибрано групи, що складається з: циспластина, лапатініба, эрлотиниба, гемцитабина, доксорубіцину, паклітакселу, цитарабіну і доцетаксела. Спосіб дозволяє підвищити ефективність лікування раку, зменшити побічні ефекти. 4 з.п.ф-ли, 11 пр., 16 іл.
Up!
Таблиця 3
ЯєчникиШкіраХвістКістковий мозокМозокМ'язиСерце
VVTK-/FCU12,2-740,1-2413,5-7,1040-8000-1,80-220-0,3
VVTK-F2L/FCU10-1080-880,8-16,3н/про0-0,20-1,80,2