Штам bifidobacterium longum, придатний для застосування в імуномодуляції, індукції продукції цитокінів, лікуванні аутоімунного захворювання, контролі відносини il - 10:il - 12, і його використання

 

Область техніки, до якої належить винахід

Даний винахід відноситься до штаму біфідобактерій {Bifidobacterium) і його використання як пробіотичних бактерій, зокрема, в якості імуномодулюючої биотерапевтического речовини.

Рівень техніки

Механізми захисту шлунково-кишкового тракту людини від його колонізації кишковими бактеріями виключно складні і включають імунні та неімунні взаємодії (1). Вроджені захисні механізми включають низький pH шлунку, жовчні солі, перистальтику, муциновие шари і антимікробні речовини та сполуки, такі, як лізоцим (2). Імунні механізми включають спеціалізовані лімфоїдні освіти, підстилаючі М-клітини (звані також комплексами Пейера), розподілені по всій тонкої і прямої кишки (3). Люминальние антигени, присутні в даних місцях, стимулюють розвиток субпопуляцій Т - і В-клітин з утворенням цитокінових мереж і вироблення антитіл в шлунково-кишковий тракт (4). Крім того, антигени можуть потрапляти через епітеліальні клітини до інтраепітеліальним лімфоцитів і до иммуноцитам знаходиться під ними власної пластини слизової оболонки (5). Таким чином, людина витрачає значні�ольшое поверхнею, за допомогою якої людина контактує з навколишнім середовищем, йому необхідні спеціальні механізми, за допомогою яких регулюється імунну відповідь на 100 тонн їжі, яка проходить через шлунково-кишковий тракт протягом середнього часу життя людини. Крім того, кишечник населяють більше 500 видів бактерій, концентрація яких в прямій кишці становить 1011-1012/р. В зв'язку з цим регулюючі механізми повинні бути здатні розрізняти не патогенні бактерії, нормально живуть в кишечнику, від навал патогенів, які можуть викликати серйозні проблеми у господаря. Кишкова флора активно бере участь у захисті господаря, борючись з попадають через травну систему потенційно патогенними мікроорганізмами.

Вважається, що деякі види пробіотичних бактерій більш ефективні, коли вони отримані з видів, для лікування яких призначені, або близько споріднених видів. Тому існує потреба у пробіотичних штами, отриманих з тварин-компаньйонів, і відмінних від штамів, отриманих від людей, які можна було б використовувати для лікування тварин-компаньйонів.

У публікації WO 01/90311 описані пробіотичні мікроорганізми, виділені з образц�досить багато зразків, і тому вони не можуть представляти собою частину природної флори, присутньої у верхніх відділах шлунково-кишкового тракту.

Відповідно, існує потреба у штамах бактерій, одержуваних шляхом виділення з природної флори, присутньої у верхніх відділах шлунково-кишкового тракту, особливо придатних для кішок і володіють пробіотичними властивостями і здатністю виживати в процесі їх обробки. Існує також потреба у складах, що містять такі штами і зручних у використанні.

Сутність винаходу

У цьому винаході пропонується виділений штам біфідобактерій №41675 за NCIMB.

Штам біфідобактерій може бути у формі живих клітин. Штам біфідобактерій може бути у формі не живих клітин.

Біфідобактерії можуть бути виділені із зразків тканини товстої кишки здорових кішок, взятих шляхом біопсії.

Штам біфідобактерій може володіти значним иммуномодулирущим дією при оральному споживанні.

У цьому винаході пропонується також склад, що містить згаданий штам біфідобактерій.

Склад може додатково містити пробіотичний матеріал. Склад може додатково містити пребіотичний м�оже бути одним з фармацевтично прийнятних носіїв, таким, як, наприклад, капсула, таблетка, порошок. Носієм для орального прийому може бути також харчовий продукт, такий, як, наприклад, масляна суспензія, суспензія на основі молока, сир, склад на основі какао-масла, соус і/або складу на основі йогурту.

У цьому винаході пропонується також продукт харчування, що містить штам біфідобактерій або складу у відповідності з цим винаходом.

Продукт харчування може бути може бути сухим продуктом харчування. Продукт харчування може бути вологим продуктом харчування. Продукт харчування може бути кормом для тварин-компаньйонів.

У цьому винаході пропонуються також штам біфідобактерій, або склад, або продукт харчування у відповідності з цим винаходом, які можуть використовуватися в якості лікарського засобу.

У цьому винаході пропонуються також штам біфідобактерій, або склад, або продукт харчування у відповідності з цим винаходом, які можуть використовуватися для профілактики та/або лікування небажаних запальних процесів.

У цьому винаході пропонуються також штам біфідобактерій, або склад, або продукт харчування у відповідності з цим винаходом, які могуѼ тракті.

У цьому винаході пропонуються також штам біфідобактерій, або склад, або продукт харчування у відповідності з цим винаходом, які можуть використовуватися для профілактики та/або лікування аутоімунних порушень, викликаних небажаними запальними процесами.

У цьому винаході пропонуються також штам біфідобактерій, або склад, або продукт харчування у відповідності з цим винаходом, які можуть використовуватися для профілактики та/або лікування діарейних станів, викликаних небажаними запальними процесами.

У цьому винаході пропонуються також штам біфідобактерій, або склад, або продукт харчування у відповідності з цим винаходом, для корекції або поліпшення роботи імунної системи тварин-компаньйонів.

У цьому винаході пропонуються також штам біфідобактерій, або склад, або продукт харчування у відповідності з цим винаходом, які можуть використовуватися для профілактики та/або лікування аутоімунних захворювань у тварин-компаньйонів.

У цьому винаході пропонуються також штам біфідобактерій, або склад, або продукт харчування у відповідності з цим винаходом, які можуть испредлагается штам біфідобактерій AH121A (номер за NCIMB 41675), а також його мутанти і варіанти.

Мутант може бути генетично модифікованим мутантом. Варіант може бути природно зустрічається варіантом біфідобактерій.

Штам може отриманий шляхом виділення з розрізаного і промитого котячого шлунково-кишкового тракту.

Штам може бути пробіотиком. Штам може бути у формі біологічно чистої культури.

У цьому винаході пропонується також виділений штам біфідобактерій, номер за NCIMB 41675.

Штами біфідобактерій можуть бути у формі живих клітин. В якості альтернативи, штами біфідобактерій можуть бути у формі не живих клітин.

Як правило, пробіотичні бактерії використовуються у формі живих клітин. Проте можливе їх використання і у формі не живих клітин, наприклад, у вигляді забитих культури або складів, що містять корисні фактори, экспрессируемие пробіотичними бактеріями. Мертві культури можуть містити мікроорганізми, вбиті під впливом високої температури, екстремальних значень pH або тиску. При використанні не живих клітин виготовлення кінцевого продукту з них спрощується, вони можуть бути включені в широке розмаїття фармацевтичних форм, і умови зберігання препаратів з писано успішне використання вбитих високою температурою клітин штаму Lactobacillus casei YIT 9018 для лікування та/або профілактики росту пухлин.

У цьому винаході пропонується також використання бактерій, одержуваних виділенням з розрізаного і промитого котячого шлунково-кишкового тракту, для збереження і поліпшення здоров'я тварини-компаньйони, а також використання складів, що містять молочнокислі бактерії.

У цьому винаході пропонується також склад, що містить пропонований штам біфідобактерій. Склад може включати ще один пробіотичний матеріал. Склад може включати пребіотичний матеріал.

Біфідобактерії є симбіотичними мікроорганізмами. Вони були виділені з мікрофлори шлунково-кишкового тракту людини. Імунна система шлунково-кишкового тракту не дає вираженої реакції на представників даної мікрофлори, так як інакше виникла запальна реакція зруйнувала б також клітини-господарі і порушила б функціонування тканин. Тому існують певні механізми, завдяки яким імунна система може розпізнавати не патогенних членів сімейства шлунково-кишкової мікрофлори і відрізняти їх від патогенних організмів. Це забезпечує збереження клітин-господарів з одного боку, і підтримання необхідного захисного бар'єру від патогенної флори, з іншого �тант» включають штам біфідобактерій, генетичні та фенотипічні властивості якого відрізняються від відповідних властивостей батьківського штаму. Термін «зустрічається в природі варіант штаму Bifidobacterium longum» передбачає організми, відібрані в результаті селекції з організмів, в яких відбулися спонтанні зміни цільових властивостей. Навмисні зміни властивостей батьківського штаму здійснюються звичайними генно-інженерними методами (in vitro), такими, як розрив генів, коньюгационний перенесення та інші. Термін «генетичне модифікування» включає введення екзогенних та/або ендогенних послідовностей ДНК в геном штами біфідобактерій, наприклад, шляхом їх введення в геном бактеріального штаму допомогою векторів на основі плазмідної ДНК бактеріофагів.

Терміни «природні мутації» і «індуковані мутації» включають зміни щонайменше одного заснування шляхом делеції, вставки, поводження чи інших змін ДНК, які можуть приводити до зміни амінокислотної послідовності, кодованої послідовності ДНК.

Терміни «мутант», «варіант» і «генетично модифікований мутант» включають також штам біфідобактерій, який був підданий генетичним змінам, які наку�еским змін, які відбуваються в результаті спонтанних мутацій, придбань і/або втрат, які не можуть бути отримані шляхом навмисних (in vitro) перетворень геному, але які можуть бути отримані шляхом природного відбору варіантів і/або мутантів, і які забезпечують необхідні переваги, підвищують життєздатність бактерій при дії на них агресивних факторів середовища, таких, як, наприклад, антибіотики. Мутант може бути створений шляхом навмисної (in vitro) вставки тих чи інших генів у геном, які принципово не змінюють біохімічної функціональності організму, але продукти експресії яких можуть бути використані для ідентифікації або селекції бактерій, наприклад, які надають стійкість до антибіотиків.

Досвідченим в даній області техніки буде зрозуміло, що мутантні або варіантні штами біфідобактерій можуть бути ідентифіковані за допомогою аналізу послідовності ДНК на гомологію з батьківським штамом. Штами біфідобактерій, які мають високу ступінь ідентичності послідовності ДНК з батьківським штамом, можуть вважатися мутантними або варіантними штамами. Штам біфідобактерій, має ступінь ідентичності (гомології) послідовності ДНК з�чи 99% чи більше, може вважатися мутантним або вариантним штамом. Гомологичность послідовностей може бути визначена за допомогою програми BLAST, загальнодоступною на сайті http://www.ncbi.nlm.nih,gov/BLAST/.

Мутанти батьківського штаму включають також похідні штами біфідобактерій, які мають гомологію межгенной спейсерной полінуклеотидного послідовності 16s-23s, складову щонайменше 85%, щонайменше 90% або щонайменше 95% по відношенню до відповідної послідовності батьківського штаму. Такі мутанти можуть додатково містити мутації ДНК в інших послідовностях ДНК бактеріального генома.

Короткий опис креслень

Даний винахід буде більш зрозумілим з нижченаведеного докладного опису його втілень, що приводяться тільки в якості прикладів, супроводжуваного доданими кресленнями.

Фіг.1. Фотографія В. longum AH121A, вирощених на агарі з барвником конго червоний.

Фіг.2. Стовпчикова діаграма, що відображає ставлення експресії IL-10:IL-12р70 в мононуклеарах периферичної крові, не стимульованих і стимульованих штамом Bifidobacterium longum AH121A;

Фіг.3. Стовпчикова діаграма, що відображає виживаність бактерій штаму AH121A в умовах низьких значень рн (бактерії находе діаграми, відображають вироблення цитокінів в культурах in vitro мононуклеарів периферичної крові.

Фіг.7А-7Е. Графіки індукції IL-10 (пг/мл) у мононуклеарах периферичної крові після стимуляції in vitro в залежності від кількості бактерій в лунці, для штамів AH121A і Bifidobacterium 35624;

Фіг.8A-8D. Графіки індукції IL-1β (пг/мл) у мононуклеарах периферичної крові після стимуляції in vitro в залежності від кількості бактерій в лунці, для штамів AH121A і Bifidobacterium 35624;

Фіг.9A-9D. Графіки індукції IL-6 (пг/мл) у мононуклеарах периферичної крові після стимуляції in vitro в залежності від кількості бактерій в лунці, для штамів AH121A і Bifidobacterium 35624;

Фіг.10A-10D. Графіки індукції IL-8 (пг/мл) у мононуклеарах периферичної крові після стимуляції in vitro в залежності від кількості бактерій в лунці, для штамів AH121A і Bifidobacterium 35624;

Фіг.11A-11D. Графіки індукції IL-12p70 (пг/мл) у мононуклеарах периферичної крові після стимуляції in vitro в залежності від кількості бактерій в лунці, для штамів AH121A і Bifidobacterium 35624;

Фіг.12А-12Е. Графіки індукції TNF-α (пг/мл) у мононуклеарах периферичної крові після стимуляції in vitro в залежності від кількості бактерій в лунці, для штамів AH121A і Bifidobacterium 35624;

Фіг.13А-13С. Графіки індукції IFN-γ (пг/�для штамів AH121A і Bifidobacterium 35624;

Фіг.14A-14D. Графіки індукції G-CSF (пг/мл) у мононуклеарах периферичної крові після стимуляції in vitro в залежності від кількості бактерій в лунці, для штамів AH121A і Bifidobacterium 35624;

Фіг.15. Стовпчасті діаграми, що відображають вплив AH121A на вироблення IL-10 та IL-12p70 в людських дендритних клітинах мієлоїдного типу.

Фіг.16. Стовпчасті діаграми, що відображають вплив AH121A на людські Т-клітини, що не піддавалися впливу CD4.

Детальний опис винаходу

Штам Bifidobacterium longum AH121A був внесений в Національну колекцію промислових і морських бактерій (NCIMB - Абердін, Великобританія) 5 листопада 2009 року з присвоєнням йому номера NCIMB 41675.

Штам Bifidobacterium longum UCC35624 був внесений в Національну колекцію промислових і морських бактерій (NCIMB - Абердін, Великобританія) 13 січня 1999 року з присвоєнням йому номера NCIMB 41003.

Штам Bifidobacterium longum може бути генетично модифікованим мутантом або зустрічається в природі варіантом.

Штам Bifidobacterium longum переважно має форму живих клітин.

В якості альтернативи, штам Bifidobacterium longum може бути у формі неживих клітин.

В контексті цього опису термін «тварина-компаньйон» означає домашнє тварина. Переважно термін «живохорька, коня, корову і їм подібних тварин. Найбільш переважно «тварина-компаньйон» означає домашня тварина з сімейства котячих.

Штами молочнокислих біфідобактерій

У першому типі втілень цього винаходу, допускає безліч варіацій без відходу від ідеї і масштабів цього винаходу, пропонується штам молочнокислих бактерій роду Bifidobacteria, який може бути отриманий шляхом виділення з розрізаного і промитого котячого шлунково-кишкового тракту, і який має пробиотическим дією по відношенню до тварин. Пробіотиками називаються мікроорганізми, живі або мертві, їх компоненти, такі, як білки, вуглеводні або очищені фракції бактеріальних ферментів, які сприятливо впливають на тварину-господаря. Крім того, цей термін може бути також поширений на неживі клітини, наприклад, на мертві культури або суміші, або сполуки, що містять сприятливі фактори, що виробляються пробіотичними бактеріями. Вони можуть включати мікроорганізми, вбиті під впливом високої температури, екстремальних значень pH або тиску. Для цілей цього опису мається на увазі, що термін «пробіотики» додатково включаети окремо не зазначено інше. Такі метаболіти можуть виділятися ними в зброджується середу, або зберігатися в самих мікроорганізмів. В контексті цього опису термін «пробіотик» включає також бактерії, гомогенізовані бактерії, екстракти з бактерій, супернатанти бактеріальних ферментів та їх суміші, які надають сприятливий вплив на тварину-господаря при їх згодовуванні тварині в терапевтичних дозах.

Було визначено, що молочнокислі бактерії роду Bifidobacteria, виділені безпосередньо з розсіченого і промитого шлунково-кишкового тракту ссавців, мають спорідненість до шлунково-кишкового тракту при згодовуванні їх відповідним ссавцям у вигляді живих бактеріальних клітин, і вони також роблять значний імуномодулюючу дію на дане ссавець при згодовуванні у вигляді живих клітин, не живих клітин, або в фракционированом вигляді. І хоча теоретично це не обов'язково, вважається, що пробіотичні біфідобактерії у відповідності з цим винаходом викликають сприятливі реакції в організмі господаря, в чому і полягає їх пробіотичні дію. Було визначено, що пробіотичні біфідобактерії, виділені з розсіченого і промитого шлунково-до�изистой оболонкою епітелію і клітинами імунної системи господаря. Таке імуномодулюючу дію, у поєднанні з іншими видами впливів, що традиційно асоціюються з пробіотичними бактеріями, зокрема, запобіганням спорідненості до кишечнику патогенів за рахунок прямого на них впливу або за рахунок конкуренції за поживні речовини, забезпечує виключно високу ефективність біфідобактерії у відповідності з цим винаходом в якості пробіотичного організму.

Біфідобактерії у відповідності з цим винаходом, одержувані виділенням з розсіченого і промитого котячого шлунково-кишкового тракту, мають антимікробну дію in vitro проти ряду патогенних штамів/видів бактерій. І хоча теоретично це не обов'язково, таке антимікробну дію in vitro вказує на потенційно можливу їх пробиотическую активність у тварин in vivo, переважно по відношенню до тварин-компаньйонів, таким, як тварини сімейства котячих. Молочнокислі бактерії у відповідності з цим винаходом переважно облают антимікробну дію проти Salmonella typhimurium, Listeria monocytogenes, Listeria innocua або Eschericia coli, переважно проти суміші даних штамів, і ще більш переважно проти всіх даних штамів.

І хотѲии з цим винаходом може бути результатом різних взаємодій, в яких беруть участь молочнокислі бактерії у відповідності з цим винаходом. Розбиратися в даній області техніки раніше висловлювалося припущення, що деякі штами біфідобактерій, виділені із зразків фекалій, мають пробиотическим дією в шлунково-кишковому тракті після їх орального споживання за рахунок того, що вони утворюють бар'єрний шар на слизовій оболонці кишечника і тим самим перешкоджають кріпленню до слизової оболонці патогенних організмів. Це потребує споживання «живих», а точніше, життєздатних клітин бактерій, так, щоб в кишечнику прижилася колонія таких бактерій. Ми, однак, вважаємо, що біфідобактерій у відповідності з цим винаходом, отримані виділенням з розсіченого і промитого котячого шлунково-кишкового тракту, можуть володіти значним пробиотическим дією при їх споживанні у життєздатною формою, так і не життєздатною формою, завдяки виробленню, при бродінні in vitro, речовини або речовин, які інгібують ріст патогенних мікроорганізми, або вбивають патогенні мікроорганізми, та/або посилюють імунну здатність тварини-господаря. Така форма пробіотичної дії дуже бажана, так як при ній бЂур або очищених продуктів бродіння і тим не менш надавати на тварину-господаря сприятливий лікувальний ефект.

Переважно, щоб молочнокислі бактерії у відповідності з цим винаходом могли зберігати життєздатність після проходження через шлунок. Це бажано для того, щоб живі культури бактерій можна було приймати внутрішньо, і після проходження ними через стравохід і шлунок вони могли колонизовать шлунково-кишковий тракт. Колонізація шлунково-кишкового тракту молочнокислими бактеріями у відповідності з цим винаходом бажана для того, щоб вони могли надавати на тварину-господаря довготривале сприятливе пробіотичні вплив. Оральний прийом не життєздатних клітин або виділених з них компонентів також дає тимчасові переваги, але так як бактерії в даному випадку є не життєздатними, вони не можуть рости і постійно чинити пробіотичні дію in situ. В результаті цього може знадобитися постійний прийом доз біфідобактерій господарем, щоб підтримувати забезпечуються ними переваги для здоров'я господаря. На противагу цьому, життєздатні клітини, які здатні пройти через шлунково-кишковий тракт і залишитися життєздатними, ко�ивают постійний пробіотичний ефект in situ. Тому бажано, щоб молочнокислі бактерії у відповідності з цим винаходом зберігали життєздатність після знаходження в середовищі-суспензії, що має pH 2.5, протягом 1 години. В контексті цього опису термін «зберігати життєздатність» означає, що щонайменше 25% бактерій, спочатку поміщених у суспендированную живильне середовище, залишаються життєздатними за результатами методу чашкового підрахунку, відомого досвідченим в даній області техніки. Термін зберігати життєздатність» переважно означає, що принаймні 50% бактерій, спочатку поміщених у суспендированную живильне середовище, залишаються життєздатними. При цьому бажано також, щоб молочнокислі бактерії у відповідності з цим винаходом зберігали життєздатність при впливі на них середовища з низькими значеннями рн, оскільки це відображає вплив на них шлункового соку в шлунку та верхньому відділі кишечнику in vivo при оральному їх споживанні тваринами.

Штам молочнокислих бактерій виду Bifidobacteria, одержуваних виділенням з розсіченого і промитого котячого шлунково-кишкового тракту, може використовуватися для забезпечення пробіотичної дії при його ора�ри сприятливого впливу орального споживання пропонованих біфідобактерій на складові здоров'я і фізіології тварини включають терапевтичне зняття симптомів або профілактику хворобливих станів, таких, як запальні розлади, імунодефіцит, хвороба запаленого кишечника, синдром подразненого кишечника, рак (особливо новоутворення шлунково-кишкового тракту й імунної системи), діарея стану, діарея, пов'язана з прийомом антибіотиків, апендицит, аутоімунні захворювання, розсіяний склероз, хвороба Альцгеймера, амілоїдоз, ревматоїдний артрит, артрит, патологічна рухливість суглобів, цукровий діабет, резистентність до інсуліну, бактеріальні інфекції, вірусні інфекції, грибкові інфекції, пародонтоз, хвороби сечостатевої системи, травми, спричинені хірургічним втручанням, метастатична хвороба, викликана хірургічним втручанням, сепсис, втрата ваги, надмірна вага, надмірне накопичення жирової тканини, анорексія, напади лихоманки, кахексія, загоєння ран, виразок, інфекції шлунково-кишкового тракту, алергія, астма, респіраторні захворювання, порушення системи кровообігу, ішемічна хвороба серця, анемія, розлади апарату згортання крові, захворювання нирок, хвороби центральної нервової системи, хвороби печінки, порушення харчування, остеопороз, ендокринні захворювання, хвороби шкірних покривів. Найбільш віддайте перевагу�ок в ток і профілактику діареї, корекцію імунної системи, переважно лікування або профілактику аутоімунних захворювань і запалень; збереження чи поліпшення стану здоров'я шкірних покривів і вовни, переважно лікування або профілактику атопічних захворювань шкіри, усунення або зменшення ефектів старіння, включаючи рівень свідомості та розумової активності; запобігання розладів, пов'язаних з віссю гіпоталамус-гіпофіз-наднирник, поліпшення стану суглобів, у тому числі їх рухливості.

Результати лікування перерахованих вище захворювань можуть бути оцінені за допомогою способів, відомих досвідченим в даній області техніки. Так, наприклад, запальні розлади, включаючи аутоімунні захворювання, можуть бути виявлені і спостерігатися з використанням таких тестів на роботу імунної системи in vivo, як бластогенез лімфоцитів, активність природних клітин-кілерів, вироблення антитіл у відповідь на вакцини, затримана гіперчутливість та їх поєднання. Нижче наводиться короткий опис цих методів, хоча вони добре знайомі досвідченим в даній області техніки.

1. Бластогенез лімфоцитів. В ході даного тесту вимірюється проліферативна реакція in vitro лімфоцитів, виділених з свіжої цілий�ня Т - і В-клітин. Для проведення даного тесту з цільної крові виділяли мононуклеари периферичної крові за допомогою методів центрифугування і розподілу щільності по Ficoll-Hypaque. Виділені мононуклеари периферичної крові двічі промивали в середовищі RPMI 1640 з додаванням HEPES, L-глютамін і пеніциліну/стрептоміцину. Відмиті клітини ресуспендували в середовищі RPMI 1640, визначали їх кількість і доводили до необхідного значення концентрацію клітин. 2×105клітин піддавали впливу діапазону концентрацій (від 0,1 мкг/мл до 100 мкг/мл) різних митогенов, деякі приклади яких включали митоген фитолакки (виробництва Gibco), фітогемаглютинін (Gibco) і конконавалин А (виробництва Sigma), триразово протягом 72 годин при температурі 37°C і в атмосфері, що містила 5% CO2, з додаванням 10% ембріональної бичачої сироватки (виробництва Sigma). Через 54 години клітини опромінювали Н-тимидином активністю 10 мкКи, після чого клітини збирали і проводили підрахунок сцинтиляцій з допомогою приладу TopCount NXT в 72 години.

2. Активність природних клітин-кілерів. Як зазначено в патенті США 6310 090, даний тест дозволяє виміряти активність in vitro природних клітин-кілерів, виділених з свіжої крові піддослідних і контрольних живіт�ки цитотоксичної активності NK-клітин використовувалися клітини аденокарциноми щитовидної залози кішок. Попередньо було показано, що використовується клітинна лінія була чутлива, тобто побивалася NK-клітинами кішок. Клітини-мішені вирощували в колбі Т75, що містила 20 мл мінімальної середовища (MEM виробництва Sigma Chem. Co., Сент-Луїс, штат Міссурі, США) з додаванням 10% ембріональної бичачої сироватки, 100 од/мл пеніциліну і 100 мкг/мл стрептоміцину. Після досягнення конфлюэнтности клітини-мішені обробляли трипсином, тричі промивали і ресуспендували в повній середовищі (RPMI-1640+10% ембріональної бичачої сироватки +100 од/мл пеніциліну +100 мкг/мл стрептоміцину) до концентрації 5×105клітин/мл По три аликвоти клітин-мішеней об'ємом 100 мкл наносили піпеткою на планшет з 96 лунками з U-подібним дном (виробництва Costar, Кембридж, штат Массачусетс) і інкубували протягом 8 годин в якості підготовки клітин для кращої адгезії один до одного. Після цього до клітин-мішеней додавали лімфоцити (клітини-ефектори, 100 мкл), виділені центрифугуванням за Ficoll-Hypaque (як описано вище), так що відношення кількості клітин-ефекторів до кількості клітин-мішеней (відношення Е:Т) складало 10:1. Після 10 годин інкубації при температурі 37°C додавали 20 мкл субстрату, що містить 5 мкг 3-(4,5-диметилтиазол-2-іл)-2,5-дифенилсивали. Кристали формазана розчиняли шляхом додавання 200 мкл 95%-ного етанолу. Оптичну густину вимірювали на довжині хвилі 570 нм за допомогою зчитувального пристрою для мікропланшетів. Відсоток специфічного лізису NK-клітин розраховували наступним чином:

Специфічна цитотоксичність (%)=

100×{1-[(ODклітин-мішеней і клітин-ефекторів-ODклітин-ефекторів)/(ODклітин-мішеней)]}

3. Вироблення антитіл при реакції на вакцини. Піддослідним суб'єктам давали набір (до 5 вакцин) через щонайменше 12 тижнів після годування пробіотиком або контрольного годування. Вакцини можуть бути сумішшю вакцин для первинної і повторної вакцинації. Не обмежують приклади наборів вакцин, які можуть використовуватися для даного тесту, можуть включати суміші вакцин виробництва Fort Dodge Animal Health. He обмежують приклади вакцин, які можуть використовуватися для даного тесту, можуть включати вакцини від котячої чуми, аденовірусної інфекції, корона-вірусної інфекції, парагрипу і парвовируса. Конкретний тип вакцин визначає також історія вакцинації піддослідного суб'єкта. Рівень антитіл, специфічних до введеної вакцини, в крові вимірювали протягом 3 тижнів, і таким чином визначав�иперчувствительность уповільненого типу. Даний тест являє собою метод неінвазивної оцінки стану імунної системи in vivo. У ході тесту проводиться підшкірна ін'єкція поліклонального митогена «фитогеммаглютинин» (РНА) в поєднанні з овечими еритроцитами, як мультівалентной вакцини, гістаміну (100 мкл гістамін-фосфату 0,0275 г/л виробництва Greer, Ленуар, штат Північна Кароліна, США) або сольового розчину з фосфатним буфером (PBS 8,5 г/л виробництва Sigma). Імунна відповідь вимірювали і записували у вигляді товщини шкірної складки з допомогою штангенциркуля через 0, 24, 48 і 72 години після ін'єкції. Збільшена товщина шкірної складки свідчить про більшу гіперчутливості імунної відповіді, яка може бути зменшена за рахунок лікування бактеріями у відповідності з цим винаходом.

Додаткові методи для оцінки ефекту від вживання біфідобактерій у відповідності з цим винаходом описані в патентах США 6133323 і 6310090.

Крім того, ефективність усунення ефектів старіння може бути визначена методами подвійної рентгенівської абсорбціометріі або скануючої комп'ютерної томографії, дозволяють визначити масу жиру в організмі і вміст мінералів у кістках. Подібним чином, даний метод може�ти кісткових тканин піддослідних суб'єктах після перенесеної інфекції.

Біфідобактерії у відповідності з цим винаходом можуть також використовуватися для зниження рівня стресу у тварин-компаньйонів. Для визначення рівня стресу, а також при його подальшої корекції і зниженні можуть бути виміряні рівні гормонів стресу в крові, таких, як епінефрин, норепінефріну, допамін, кортизол, С-реактивний білок та інші білки гострої фази. Дані гормони впізнаються биомаркерами стресу, і їх зміст може бути легко визначений способами, добре відомими досвідченим в даній області техніки. Крім того, за допомогою комп'ютерної томографії може бути безпосередньо виміряти размерен розмір наднирника, як показник активності осі гіпоталамус-гіпофіз-наднирник in vivo.

Крім того, шляхом оцінки стану шкірно-вовняного покриву тварини-компаньйони, що проводиться досвідченим фахівцем, можуть бути виявлені проблеми з шкірним і вовняним покривом, і спостерігатися прогрес у поліпшенні стані шкірно-вовняного покриву. Приклади критерій оцінки шкірно-вовняного покриву можуть включати: а) показник линьки - визначається за стандартною процедурою, при якій розчісують шерсть, збирають і зважують вичесанние волосся, і по їх вазі порівнюють испитиваемоорам, як линька, лупа, блиск, однорідність, м'якість і щільність вовни; з) функціональну оцінку бар'єрної функції шкіри - проводиться шляхом протирання ділянки шкіри марлею, змоченою в ацетоні. При даному методі з шкіри видаляється одноклітинний шар, в результаті чого на даній ділянці шкіри порушується її бар'єрна функція, що забезпечується липидними фракціями рогового шару. Порушення бар'єрної функції характеризується кількісно шляхом вимірювання збільшення трансэпидермальной втрати води (TEWL) і ступеня почервоніння пошкодженої ділянки шкіри способами, добре відомими досвідченим в даній області техніки. Почервоніння вимірюється в балах за допомогою спеціальної камери і системи освітлення. Показники втрати води (TEWL) і почервоніння в балах вимірюються до обробки шкіри, відразу після обробки, в кінці 5-го і 24-го години після обробки, і на підставі цих даних оцінюється стан захисних і ранозаживляющих функцій шкіри.

Крім того, лікування інфекцій шлунково-кишкового тракту у тварин-компаньйонів може включати поліпшення стану їх бактеріальної мікрофлори. Поліпшення стану мікрофлори у тварин-компаньйонів переважно включає зменшення вмісту кількості патогенниѼожет бути визначено кількісно стандартним методом чашкового підрахунку, відомим досвідченим в даній області техніки. До патогенних бактерій переважно відносяться бактерії, обрані з групи, що складається з бактерій видів Clostridia, Escherichia, Salmonella, їм подібних і їх сумішей. Не обмежують приклади відповідних штамів патогенних бактерій включають С. perfringens, С. difficile, Eschericia coli, Salmonella typhimurium та їх суміші.

Спосіб використання бактерій у відповідності з цим винаходом може також включати профілактику чи лікування хвороб сечового тракту домашніх тварин, переважно тварин-компаньйонів. Не обмежують приклади лікування або профілактики хвороб сечового тракту можуть включати лікування або профілактику інфекцій сечового тракту, лікування або профілактику хвороб нирок, включаючи кам'яну хворобу, лікування або профілактику інфекцій сечового міхура і їм подібних хвороб. І хоча теоретично це не обов'язково, автори вважають, що біфідобактерії у відповідності з цим винаходом можуть бути корисними для запобігання описаних вище хворобливих станів завдяки своїй здатності розкладати щавлеву кислоту, що було показано в дослідах in vitro. Щавлева кислота є побічним продуктом процесів метаболізму, що відбуваються в сечовому�иря та інших відділів сечових шляхів. За рахунок розкладання солей щавлевої кислоти і запобігання їх накопичення і випадіння в осад в сечових шляхах, бактерії у відповідності з цим винаходом можуть використовуватися для лікування і профілактики інфекцій і інших хворобливих станів сечових шляхів. Розкладання щавлевої кислоти може бути виміряно in vitro за допомогою набору №755699, пропонованого Boehringer Mannheim/R-Biopharm.

Біфідобактерії у відповідності з цим винаходом можуть бути використані для збереження і поліпшення здоров'я тварини-компаньйони за рахунок поліпшення перетравлювання волокон. Поліпшення переварювання волокон є дуже бажаним, оскільки воно сприяє зростанню згаданих біфідобактерій і розвитку сприятливого ендогенної мікрофлори, яка в свою чергу сприяє придушенню деяких потенційно патогенних бактерій. Крім того, повідомлялося про зменшення кількості токсичних метаболітів і шкідливих ферментів, що утворюються в процесах бродіння, викликаних патогенними мікроорганізмами у людей (6). Ступінь перетравлення волокон може бути визначена за методом, описаним Vickers з співавторами (7), з тією відмінністю, що замість інокуляції розбавлених зразків фекалій повинні використовуватися чисті кѹства котячих, можуть бути використані для зменшення смердючих запахів фекалій і сечі з лотків для туалету тварин-компаньйонів, за рахунок зменшення утворення сполук у фекаліях та сечі, які викликають неприємні запахи. Не обмежують приклади сполук, що викликають неприємні запахи, містять аміак, індол, фенол, аміни, жирні кислоти з розгалуженими ланцюгами і леткі сполуки, що містять сірку. І хоча теоретично це не обов'язково, можна очікувати, що зменшення вмісту даних сполук у фекаліях або сечі тварини-компаньйони призведе до ослаблення неприємних запахів, що виходять від фекалій і сечі.

Спосіб використання молочнокислих бактерій у відповідності з цим винаходом в цілому передбачає їх оральне споживання твариною. Оральне споживання може являти собою частину звичайного режиму харчування, або може проводитися на додаток до нього. Оральне споживання проводиться щонайменше раз на місяць, переважно - щонайменше раз на тиждень, і ще краще - щонайменше раз на день. Молочнокислі бактерії у відповідності з цим винаходом можуть видаватися домашній тварині, переважно тварині-компаньйону, в терапесте цього опису термін «терапевтично ефективна кількість» по відношенню до молочнокислим бактеріям означає, що кількість бактерій є достатнім для забезпечення необхідного впливу на тварину, яка потребує такого лікування, і в той же час досить малою, що дає змогу уникнути таких побічних ефектів, як токсичність, роздратування або алергічна реакція, тобто забезпечується розумне відношення користь/ризик при прийомі бактерій у відповідності з цим винаходом. Конкретне «терапевтично ефективна кількість» у кожному випадку буде залежати від таких факторів, як конкретний діагноз тварини, фізичний стан тварини, тривалість лікування, призначені дози, можливе наявність одночасно проведеного лікування, використовуваний носій, розчинність форми препарату і конкретний режим дозування.

Молочнокислі бактерії переважно призначаються тварині-компаньйону в дозі від 1,0×104ДЕЩО в день до 1,0×1014ДЕЩО в день, переважно - від 1,0×106ДЕЩО в день до 1,0×1012ДЕЩО в день. Склад згідно з цим винаходом переважно містить щонайменше 0,001% молочнокислих бактерій, тобто від 1,0×104КУО/г до 1,0×1011КУО/г молочнокислих бактерій роду Bifidobacteria, виділених з розсіченого і промитого котячого желѵнних клітин, дистилятів, ізолятів або інших фракцій продуктів ферментації молочнокислих бактерій у відповідності з цим винаходом, або будь-яких їх сумішей.

Переважно, щоб молочнокислі бактерії, або виділені або очищені їх фракції використовувалися для приготування складів, призначених для збереження чи поліпшення стану здоров'я тварини. Як було сказано вище, склад може являти собою частину звичайного раціону харчування, або даватися тварині додатково. У випадках, коли склад є частиною звичайного раціону харчування, він може бути у формі сухого корму для тварин, наприклад, печива або гранул, або корму з обробленого зерна, вологого корму для тварин, йогуртів, соусів, продуктів для жування, частувань та іншого.

Такі суміші можуть містити додаткові компоненти. Такі додаткові компоненти можуть бути корисними для включення до запропоновані склади, але в контексті цього винаходу вони є лише додатково можливими. Так, наприклад, харчові склади переважно повинні бути збалансовані по живильній цінності. В одному з втілень харчові склади можуть містити (у перерахунку на суху речовину) від приблизно 20% до примостава. Сирої білковий матеріал може містити будь-який матеріал, вміст білка в якому становить щонайменше 15% по вазі, і не обмежують приклади таких матеріалів включають матеріали рослинного походження, що містять білок, такі, як соєві боби, насіння бавовни і арахіс, матеріали тваринного походження, що містять білок, такі як казеїн, альбумін і продукти на основі м'язових тканин. Не обмежують приклади продуктів на основі м'язових тканин, які можуть використовуватися у відповідності з цим винаходом, включають свіже м'ясо, а також висушені і топлені м'ясні продукти, такі, як рибний корм, корм з птахів, м'ясний корм, корм з кісток і їм подібні. Інші типи відповідних джерел сирого білка містять клейковину пшениці або кукурудзи, а також білки, екстраговані з джерел на основі мікроорганізмів, таких, як дріжджі.

Крім того, харчові склади можуть містити, у перерахунку на суху речовину, приблизно від 5% до приблизно 35% жиру, переважно від приблизно 10% до приблизно 30% жиру за вагою від сумарної ваги харчового складу. Крім того, харчові склади, що містять молочнокислі бактерії у відповідності з цим винаходом, можуть також містити ак описано в WO 99/51 108.

Склади у відповідності з цим винаходом можуть додатково містити джерело вуглеводнів. Прикладами таких джерел є зернові або злакові, такі, як рис, кукурудза, ячмінь, люцерна, пшениця і їм подібні продукти. Крім того, склади також можуть містити інші матеріали, такі, як суха молочна сироватка або інші молочні продукти.

Сполуки, що містять бактерії у відповідності з цим винаходом, можуть також містити пребіотик. Термін «пребіотик» включає речовини або сполуки, які зброджуються кишковою флорою тварини-компаньйони і тим самим сприяють зростанню або розвитку молочнокислих бактерій в шлунково-кишковому тракті тварини-компаньйони на шкоду патогенним бактеріям. В результаті такого бродіння виробляються жирні кислоти, особливо виробляються коротколанцюгові жирні кислоти в товстій кишці. Результатом цього є зниження значення pH в товстій кишці. Не обмежують приклади відповідних пребіотиків включають олігосахариди, такі, як інулін і продукти його гідролізу, відомі як фруктоолігосахариди, галакто-олігосахариди, кисло-олігосахариди і оліго-похідні крохмалю. Пребіотик може входити в состаодержащего волокно. Відповідні рослинні матеріали включають спаржу, артишоки, цибулю, пшеницю або цикорій, або продукти, що залишаються при переробці даних рослинних матеріалів. В якості альтернативи, пребіотичну волокно може входити в склад у вигляді инулинового екстракту, наприклад, придатними є екстракти цикорію. Відповідні инулиновие екстракти пропонуються Orafti SA (Бельгія) під торговим найменуванням "Raftiline". Так, наприклад, в якості джерела інуліну підходить препарат Raftiline (g) ST, який представляє собою дрібний білий порошок, що містить приблизно від 90% до 94% за вагою інуліну, приблизно до 4% за вагою глюкози і фруктози і приблизно від 4% до приблизно 9% сахарози.

В якості альтернативи, волокно може бути у вигляді фруктоолигосахарида, такого, як "Raftilose", пропонованого Orafti SA (Бельгія). Підходить, наприклад, продукт Raftilose (g) P95. В якості альтернативи, фруктоолігосахариди можуть бути отримані гідролізом інуліну, ферментативними методами з використанням мікроорганізмів.

Відповідним процесом отримання сухого корму для тварин-компаньйонів є варіння з екструдуванням, хоча можуть використовуватися і спікання, та інші відповідні процеси. При використанні варіння з екструзія бути змішаний з іншими компонентами корму для тварин перед їх подальшою обробкою. Відповідний процес описаний, наприклад, в Європейській патентній заявці No 0850569. При використанні пробіотичного мікроорганізму бажано, щоб такий організм був нанесений у вигляді шару покриття на сухий корм для тварин-компаньйонів, або зсередини заповнював сухий корм для тварин-компаньйонів. Схожий процес описаний, наприклад, в Європейській патентній публікації ЄР 0862863.

Якщо склад має вигляд вологого корму, то для виготовлення м'ясних продуктів, що містять м'ясо і стимульованих біфідобактеріями, можуть використовуватися процеси, описані в патентах США 4781939 і 5132137. Можуть також використовуватися і інші процеси для виготовлення продуктів типу цілісного м'яса, наприклад, варіння у паровий печі. В якості альтернативи, можуть бути виготовлені продукти типу ковбасного фаршу шляхом емульсіфікаціі відповідного м'ясного матеріалу, додаванням відповідного желюючий агент, нагрівання м'ясної емульсії з желюючою агентом і подальшого наповнення жерстяних банок або інших відповідних контейнерів. Як правило, вологі суміші для годівлі тварин можуть містити від приблизно 7% до приблизно 15% білка, приблизно від 1% до приблизно 10% жиру, і від приблизно 1% до приблизно 7% волокна. Не обмежують�ну, яловичину, білу рибу, курячий бульйон, индюшиний бульйон, яловичий бульйон, печінка курчат, пивоварний рис, висівки кукурудзяні, рибний корм, яйця, цукрову масу, хлориди, лляну масу, баранину, відходи виробництва яловичини або курятини та їх суміші. В іншому втіленні склади, що використовуються в якості харчових добавок, таких, як печива, жувальні продукти або інші «частування», можуть містити, у перерахунку на суху речовину, приблизно від 20% до приблизно 60% білка, або від приблизно 22% до приблизно 40% білка за вагою від ваги складу. Ще в одному прикладі склади, які використовуються у якості харчових добавок, можуть містити, у перерахунку на суху речовину, приблизно від 5% до приблизно 35% жиру, або приблизно від 10% до приблизно 30% жиру за вагою, від сумарної ваги складу, який використовується як добавка. В цілому харчові склади і склади, що використовуються як добавки, призначені для тварин родини котячих, добре відомі досвідченим в даній області техніки.

Корм для тварин-компаньйонів може містити інші активні речовини, такі, як жирні кислоти з довгими ланцюгами і цинк. Відповідні жирні кислоти з довгими ланцюгами включають α-лінолеву кислоту, γ-ліноленову кислоту, ейкозапентаєнову кислоту і докозаг�ибий жир.

Відповідними джерелами гамма-ліноленової кислоти є масло бораго, масло насіння чорної смородини і масло енотери. Сафлорова олія, соняшникова олія, кукурудзяна олія та соєва олія є відповідними джерелами лінолевої кислоти. Перераховані масла можуть також використовуватися для покриття субстратів, як було описано вище. Цинк може входити до складу будь-якій зручній формі, наприклад, у вигляді сульфату цинку чи оксиду цинку. Крім того, більшість інгредієнтів, традиційно використовуваних в кормах для тварин, які є джерелами жирних кислот і цинку. Було помічено, що поєднання цикорію, як джерела пребіотика, з маслом, багатим лінолевої кислотою, таким, як, наприклад, соєва олія, дає несподівані переваги, імовірно пояснюється синергічним ефектом.

Якщо склад має форму соусу, то він переважно містить щонайменше 10% бульйону, не обмежують приклади яких включають бульйон з овочів, яловичини, курчат або шинки. Типовий склад у вигляді соусу може містити приблизно від 0,5% до приблизно 5% сирого білка, приблизно від 2% до приблизно 5% сирого жиру і від приблизно 1% до приблизно 5% волокна.

Інші не обмежують приклади добавок, які ми на основі молока, сири, склади на основі какао-масла, таблетки та капсули. Якщо склад має форму таблетки, то для збереження її цільної і спресованої форми потрібні відповідні складники. Не обмежують приклади відповідних сполучних включають натуральні смоли, такі, як ксантанова камедь, пектини, лецитини, альгінати та інші сполуки, відомі досвідченим в даній області техніки. Якщо склад має вигляд капсули, він повинен бути укладений в оболонку, як відомо досвідченим в даній області техніки. Не обмежують приклади відповідних матеріалів для оболонки включають полівініловий спирту (ПВА), полівінілпіролідон, альгінати і желатин. Склади на основі йогурту можуть містити від 1% до приблизно 5% білка, приблизно від 10% до приблизно 20% вуглеводнів, приблизно від 1% до приблизно 5% волокна, приблизно від 1% до приблизно 5% жиру і від приблизно 50% до приблизно 90% рідкого носія, такого, як молоко.

Приклади

Наведені нижче приклади даються тільки для ілюстрації цього винаходу, і не мається на увазі будь-яким чином обмежити ними масштаб цього винаходу.

Приклад 1. Виділення Bifidobacterium longum АН1714

Штам Bifidobacterium longum AH121A був виділений із зразків тканини котячого кишечника.

Обр�азії за ініціативою і з схвалення господарів. Всі тварини були здоровими і не мали будь-яких захворювань. У кожної кішки вирізали товсту, сліпу і клубову кишку і розсікали їх для оголення слизової оболонки.

Зразки тканин механічно гомогенизировали, енергійно струшували протягом 1 хвилини, і збирали супернатанти. Кожен супернатант наносили на агар de Mann Rogosa Sharpe (MRS), після чого інкубували на протязі 48 годин при температурі 37°C в приладі Anerocult GasPak. Отримані після інкубації колонії з чашок пересівали штрихом на тугіше середовище MRS і знову вирощували при тих же самих анаеробних умовах. Отримані після цього колони пересівали штрихом ще 4 рази, до тих пір, поки не отримували чисту колонію одного штаму. Під мікроскопом вивчали морфологічні властивості колонії. Відповідні ізоляти мали на реакцію за Грамом і каталазную активність. Випробування на активні фармацевтичні інгредієнти (набір API 5 OCHL виробництва BioMerieux) показало, що бактерії є грампозитивними і каталаза-негативними. Зібрані клітини двічі промивали 0,05 М фосфатним буфером (pH 6,5) і цистеїном-HCl (500 мг/л), після чого руйнували ультразвуком. За допомогою центрифугування видаляли залишки клітин. Супернатанти інкубували з NaF (6 мг/мл) і иодоацЇение 10 хвилин при кімнатній температурі. Додавали HCl (4М), FeCl3·6H2O (5% вага/об'єм 0,1 М HCl) і фруктоза-6-фосфат натрію, і спостерігали за зміною кольору. Почервоніння свідчило про утворення ацетил-фосфату з хелати заліза шляхом гідроксилювання.

Ідентифікація виду бактерій

Для додаткової ідентифікації виділених біфідобактерій проводили секвенування межгенной спейсерной області 16s (далі позначається також як IGS) за наступною методикою. З бактерій штаму AH121A виділяли ДНК з допомогою 100 мкл екстракційного розчину і 25 мкл препарационного розчину для тканини (набір реактивів XNAT2 виробництва Sigma). Зразки інкубували протягом 5 хв при кімнатній температурі, потім 2 години при температурі 95°C, після чого додавали 100 мкл нейтралізуючого розчину з того ж набору Sigma XNAT2. Визначали кількість геномної ДНК у розчині за допомогою спектрофотометра Nanodrop. Отримані зразки зберігали при 4°C. Проводили полімеразну ланцюгову реакцію з IGS-специфічними праймерами: IGS L: 5'-GCTGGATCACCTCCTTTCT-3' (ідентифікаційний №3, в результаті чого отримували послідовність з ідентифікаційним номером 1) і IGS R: 5'-CTGGTGCCAAGGCATCCA-3' (ідентифікаційний №4, в результаті чого отримували послідовність з ідентифікаційним номером 2). Вадження 30 секунд, 72°C протягом 30 секунд (28 циклів). Реакційна суміш для ПЛР містила 4 мкл (50 нг) ДНК, набір для ПЛР XNAT2 виробництва Sigma, 0.4 мкМ праймерів IGS L і IGS R (MWG Biotech, Німеччина). Реакції проводили на амплификаторе Eppendorf. Для аналізу експресії IGS продукти ПЛР (в кількості 10 мкл) поділяли в 2% агарозному гелі з буфером ТАЕ, пофарбованому бромідом этидия, з маркером молекулярної ваги (з кроком 100 пар нуклеотидів, виробництва Roche). Окремі продукти ампліфікації, відповідні окремих смугах після поділу в гелі, очищали за допомогою набору реактивів Wizard PCR виробництва Promeg. Очищені продукти ПЛР прослідковували з використанням IGS-специфічних праймерів, послідовності яких наведено вище. Розшифровані послідовності перевіряли по базі даних нуклеотидних послідовностей NCBI на гомологію з відомими послідовностями з використанням стандартної програми пошуку BLAST (http://www.ncbi.nlm.nih.gov/BLAST/). Після знаходження найбільш близьких послідовностей виробляли їх вирівнювання з досліджуваними з допомогою програми DNASTAR MegAlign. Отримані послідовності (пряма послідовність IGS, ідентифікаційний номер 1 і зворотна послідовність IGS, ідентифікаційний номер 2, - наводяться в с�довательностями IGS (пряма і зворотна), мають досить високий ступінь гомології з відповідними послідовностями бактерій Bifidobacterium longum.

Приклад 2. Скринінг на агарі з барвником конго червоний

Для фенотипового скринінгу бактеріальних штамів, які експресують EPS (позаклітинні полісахариди), використовували тест на агарі з барвником конго червоний. Процедура полягала в наступному. В 10 мл модифікованої (додаванням 0,05% цистеїну) бульонной середовища Rogosa асептично інокулював свежевиращенную колонію бактеріального штаму, після чого проводили інкубацію в анаеробних умовах при 37°C до появи каламутності (приблизно від 16 до 24 годин). Бульйонні культури асептично штриховали на чашки з агаром, що містить барвник конго червоний і інкубували при 37°с протягом 48 годин. Вважається, що EPS, вироблювані в якості побічного продукту росту і/або метаболізму певних штамів бактерій, перешкоджає поглинанню ними барвника конго червоний, в результаті чого колонія має молочно-білий колір. Штами, що виробляють менше EPS, сильніше забарвлюються барвником конго червоний, в результаті чого колонія має колір між рожевим і червоним. Штами, які взагалі не виробляють EPS, набувають червоне забарвлення і в�уклую мукоидную морфологію і яскраво-білий колір.

Приклад 3. Стійкість В. longum AH121A проти жовчних солей і низьких значень pH

Даний експеримент проводили з метою визначення стійкості ізолятів котячих бактерій В. longum AH121A проти різних концентрацій жовчі, а також для оцінки виживання бактерій при pH 2,5 протягом 6 годин.

Схема експерименту

Стійкість бактерій штаму В. longum AH121A проти жовчі визначали висіванням ліофілізованих бактерій на чашки з агаром MRS/RCA, в який була додана котяча жовч (у концентрації 0,5; 1,0; 2,0%). Оцінювали також виживання штаму при pH 2,5 протягом 6 годин, метом чашкового підрахунку, за 5 хвилин до початку інкубації і через 5, 30, 60, 120, 180 і 360 хв після початку інкубації.

Детальний опис методу

Процедура визначення стійкості бактерій проти котячої жовчі полягала в наступному.

Чашки з різною концентрацією жовчі готували з концентрованого 45%-ного розчину синтетичної жовчі, який піддавали тепловій обробці при 80°C протягом 10 хв, щоб убити сторонні живі організми.

Середовище з різною концентрацією жовчі готували наступним чином:

Середа з 2% жовчі: 6,67 мл концентрату жовчі +143,33 мл агару

Середа з 1% жовчі: 3,33 мл концентрату жовчі +146.67 мл агар�ество агару після автоклавування, і додавали замість нього відповідну кількість концентрату жовчі.

Свіжі чашки з жовчю готували щодня (хоча їх можна зберігати протягом тижня). Попередньо визначали кількість КУО/г для кожного зразка ліофілізованих бактерій методом розмазування по склу.

Бактерії наносили на чашки з містить жовч агаром шляхом ресуспендирования ліофілізованих бактерій в 10 мл стерильного буфера PBS (у концентрації 109КУО/мл), поділу чашки на 4 рівних сектора і нанесення на чашку 4 зразків штаму (по 10 мкл суспензії).

Чашки сушили протягом 30 хв (або до висихання плями суспензії на агарі), після чого проводили інкубацію бактерій у відповідних умовах.

Процедура оцінки виживання бактерій штаму AH121A в умовах з низьким значенням pH (pH 2.5) полягала в наступному.

Підкислення середовища проводили за рахунок додавання 6 М HCl. Спочатку кислоту додавали 100 мл бульйону та визначали, скільки потрібно кислоти для доведення рн такої кількості бульйону до 2,5. Відповідну кількість кислоти додавали в решту бульйону MRS (4×100 мл). Попередньо визначали кількість КУО/г для кожного зразка ліофілізованих бактерій методом розмазування по склу.9КУО/мл і інкубували в анаеробних умовах. Через 5, 30, 60, 120, 180, 240 і 360 після початку інкубації брали аликвоти, наносили на скло і визначали кількість ДЕЩО в мілілітрі зразка.

Результати

Таблиця 1
Зростання ізолятів AH121A в присутності котячої жовчі
% жовчі (вага/об'єм)0,00,51,02,0
Виживання штаму AH121A+++++++++++
+++= дуже хороший зростання (100%)
++= хороший зростання (66%)

Висновки

Вплив котячої жовчі на ріст бактерій штаму AH121A представлено в Таблиці 1. Як видно з таблиці, даного штаму бактерії здатні витримати концентрації котячої жовчі, менші 2%.

На фіг.3 показана стійкість штаму на середовищі з рн 2,5.

Приклад 4. Вплив Ст. lonsum AH121A на ставлення експресії IL-10:IL-12

З п�тва BD (номер за каталогом 362761), у відповідності з інструкцією виробника. Мононуклеари периферичної крові промивали і ресуспендували в модифікованому середовищі Glutamax™ виробництва Dulbecco, містять глутамакс (замінник глютамина) + піруват +4,5 г/л глюкози (Gibco, номер за каталогом 10569-010)+10% ембріональну бичачу сироватку (Sigma, номер за каталогом F4135), з додаванням 1% пеніциліну/стрептоміцину (Sigma, номер за каталогом Р0781). Мононуклеари периферичної крові інкубували у плоскодонних плашках з 96 лунками (2×105клітин в лунці) з додаванням 20 мкл бактеріальної суспензії (з концентрацією бактерій 1×107КУО/мл) протягом 48 годин при температурі 37°C в атмосфері, що містила 5% CO2. Після інкубації протягом 2 днів чашки центрифугували при 300 g, супернатант видаляли, і отримані зразки зберігали при температурі -80°C до подальших дослідів. Рівні інтерлейкіну 10 (IL-10) та інтерлейкіну-12р70 (IL-12p70) в супернатанте культури визначали за допомогою набору з 96 лунками виробництва Meso Scale Discovery (Гейтерсбург, штат Меріленд, США; номер по каталогу К15008В-1).

Бактерії для експериментів спільного вирощування готували двома способами: (а) свежевиращенние бактерії вирощували в середовищі Difco MRS і збирали відразу після входу в стационарнущивали при анаеробних умовах при температурі 37°C в середовищі Difco MRS і збирали відразу після входу в стаціонарну фазу. З кожного препарату бактерій готували ліофілізований порошок і зберігали при -80°C в окремій ємності у вигляді аликвот по 100 мг. Безпосередньо перед використанням за однією аликвоте кожного штаму діставали з холодильника і давали їй прогрітися до кімнатної температури. Для кожного досліду використали нову аликвоту. Кожен штам промивали 3 рази в пробірці місткістю 10 мл і потім центрифугували. Для кожного з умов зростання будували калібрувальні криві (залежність оптичної щільності від кількості живих клітин), і препарат з промитими клітинами нормалізували, щоб отримати потрібну кількість клітин, перед його додаванням до мононуклеарам периферійної крові. У всіх експериментах використовувався контроль, не містив бактерій. Всі аналізи проводили тричі.

Результати експериментів, які відображають вплив штаму AH121A на відношення рівнів експресії IL-10:IL-12, представлені на фіг.2. Результати практично однакові для свежевиращенних і ліофілізованих культур.

Приклад 5. Вплив штаму AH121A на вироблення IL-10

Наявність адекватної імунної відповіді на мікроби є важливим показником загального стану здоров'я організму-господаря. Надмірна реакція може викликати воспа�ространению патогенів в організмі. Описані нижче методи аналізу добре представлені в літературі і є корисними методами для визначення імунологічної активності організму-господаря при реакції на різні мікроби.

Для експерименту відбирали мононуклеари периферичної крові (моноцитів, дендритні клітини, В-клітини, Т-клітини) у здорових добровольців і стимулювали їх in vitro бактеріальними штамами. Супернатанти культур відбирали і визначали в них рівні цитокінів.

IL-10 - важливий цитокін, що запобігає аберрантние прозапальні імунні реакції. У тварин з виключеною експресією IL-10 розвивалися коліт і пухлини шлунково-кишкового тракту. Для запобігання подібних потенційно небезпечних імунних реакцій регуляторні клітини імунної системи виробляють і використовують IL-10. Підвищена експресія даного цитокіну є захистом від підвищеної запальної активності та надмірної імунної реакції на патогени.

Вироблення IL-10 в мононуклеарах периферичної крові in vitro визначали через 48 годин після їх сумісної інкубації з бактеріальними штамами. Штами AH121A і 35624 индуцировали вироблення IL-10 приблизно однаковою мірою (Фіг.4-6).

Приклад 6. Bifidobacterium longum АН 1714 має иммуномодули�um longum AH35624.

Матеріали і методи

Штам Bifidobacterium longum infantis UCC35624 (В624) і штам Bifidobacterium longum AH121A піддавали аналізу на індукцію цитокінів в мононуклеарах периферійної крові. Бактерії для спільного вирощування готували наступним чином. Бактерії вирощували при анаеробних умовах при температурі 37°C в середовищі Difco MRS і збирали відразу після входу в стаціонарну фазу. З кожного типу бактерій готували ліофілізований порошок і зберігали при -80°C в окремій посудині у вигляді аликвот по 100 мг. Безпосередньо перед використанням за однією аликвоте кожного штаму діставали з холодильника і давали їй прогрітися до кімнатної температури. Для кожного досліду використали нову аликвоту. Кожен штам промивали 3 рази в пробірці місткістю 10 мл і потім центрифугували.

Проводили прямий підрахунок кількості клітин під мікроскопом у лічильній камері Петрова-Хауссера у відповідності з інструкціями виробника. Перед використанням клітин для аналізу рівня цитокінів в мононуклеарах периферійної крові розчин промитих клітин нормалізували до одержання одного і того ж числа клітин в одиниці об'єму. У кожну комірку для аналізу додавали 20 мкл розчину бактерій в сольовому розчині з фосфатним буфером (PBS), для еарах периферичної крові

Мононуклеари периферичної крові виділяли з периферичної крові здорових людей за допомогою препарационних пробірок Vacutainer виробництва BD (номер за каталогом 362761), у відповідності з інструкцією виробника. Мононуклеари периферичної крові промивали і ресуспендували в модифікованому середовищі Modified Eagle Medium-Glutamax™ виробництва Dulbecco, містять глутамакс (замінник глютамина) + піруват +4,5 г/л глюкози (Gibco, номер за каталогом 10569-010)+10% ембріональної бичачої сироватки (Sigma, номер за каталогом F4135), з додаванням 1% пеніциліну/стрептоміцину (Sigma, номер за каталогом Р0781). Мононуклеари периферичної крові інкубували в плашках з 96 плоскодонними лунками (2×105клітин в лунці) з додаванням 20 мкл бактеріальної суспензії з різною концентрацією бактерій: 2,5×108, 1,0×108, 5,0×107, 2,5×107, 1,0×107і 1,0×106(всього до 6 концентрацій) протягом 48 годин при температурі 37°C в атмосфері, що містила 5% CO2. Рівні інтерлейкіну 10 (IL-10) та інтерлейкіну-12р70 (IL-12p70) в супернатанте культури визначали за допомогою набору з 96 осередками виробництва Meso Scale Discovery (Гейтерсбург, штат Меріленд, США; номер по каталогу К15008В-1). Рівні людського інтерлейкіну 1β (II-1b), людського інтер� 12р70 (И12р70), людського інтерферону-гамма (IFN-γ), людського фактора некрозу пухлин альфа (TNF-α) та людського G-CSF (гранулоцитарний колонієстимулюючий фактор) визначали кількісно і виражали в пикограммах на мілілітр (пг/мл). Для кожного зразка проводили за 3-5 дослідів (відповідають графікам А-Е на кресленнях).

Результати

Дві незалежні культури (1 і 2) штаму Bifidobacterium longum infantis UCC35624 (В624) і штам Bifidobacterium longum AH1714 досліджували на імуномодулюючі властивості методом аналізу індукції цитокінів у мононуклеарах периферичної крові при додаванні бактерій в різної концентрації: 2,5×108, 1,0×108, 5,0×107, 2,5×107, 1,0×107і 1,0×106(всього до 6 концентрацій). Супернатанти досліджували на рівні вироблення різних цитокінів, включаючи ІЛ-1β, -6, -8, -10 -12 IFN-α, IFN-γ і G-CSF. Результати вимірювань представлені у вигляді середніх значень (пг/мл) ± середньоквадратичне відхилення для різних зразків (від А до Е, тобто до 5 штук).

Порівняно зі штамом 35624, штам AH121A також давав сильну індукцію вироблення більшості цитокінів, включаючи ІЛ-10, але дещо відмінні, а саме, підвищені, рівні цитокінів IL-6 і IL-8.

IL-10: інкубація з AH121A індукує зростає з дозою бактерій вира. �арактер індукції IL-10 якісно і кількісно схожий з індукцією при інкубації зі штамом 35624. Максимуму індукції IL-10 не спостерігається аж до кількості бактерій, що становить 1,0×109в лунці.

IL-1β: інкубація з AH121A індукує зростає з дозою бактерій вироблення прозапального цитокіну IL-1β у мононуклеарах периферичної крові після стимуляції in vitro (фіг.8). Характер індукції IL-1β якісно і кількісно схожий з індукцією при інкубації зі штамом 35624. Максимуму індукції IL-1β не спостерігається аж до кількості бактерій, що становить 1,0×109в лунці.

IL-6: інкубація з AH121A індукує зростає з дозою бактерій вироблення цитокіну IL-6 в мононуклеарах периферичної крові після стимуляції in vitro (фіг.9). Характер індукції IL-6 кількісно відрізняється від індукції при інкубації зі штамом 35624: інкубація зі штамом AH121A дає більш високі рівні IL-6, особливо при малих кількостях бактерій в лунці.

IL-8: інкубація з AH121A індукує зростає з дозою бактерій вироблення цитокіну IL-8 у мононуклеарах периферичної крові після стимуляції in vitro (фіг.10). Характер індукції IL-8 кількісно відрізняється від індукції при інкубації зі штамом 35624: інкубація зі штамом AH121A дає більш високі�обробку прозапального цитокіну IL-12 у мононуклеарах периферичної крові після стимуляції in vitro (фіг.11). Характер модуляції вироблення IL-12 має колоколообразную форму при інкубації з обома штамами: AH121A і 35624: поступово досягає піку, а потім починає падати при більш високих концентраціях бактерій. Кількісно експресія IL-12 сильно варіює для різних зразків, але в середньому експресія з бактеріями AH121A аналогічна експресії з бактеріями 35624.

TNF-α: інкубація з AH121A індукує зростає з дозою бактерій вироблення прозапального цитокіну TNF-α у мононуклеарах периферичної крові після стимуляції in vitro (фіг.12). Характер індукції TNF-α якісно і кількісно схожий з індукцією при інкубації зі штамом 35624 в трьох з 5 зразків, і в 2 з 5 зразків індукція кілька сильніше (фіг.12С та 12Е). Максимальна індукція має місце при концентраціях бактерій до 1,0×108в лунці.

INF-γ: інкубація з AH121A індукує зростає з дозою бактерій вироблення прозапального цитокіну INF-γ у мононуклеарах периферичної крові після стимуляції in vitro (фіг.13). Кількісно експресія INF-γ сильно варіює для різних зразків, але в середньому експресія з бактеріями AH121A аналогічна експресії з бактеріями 35624.

G-CSF: інкубація з AH121A індукує зростає з дозою бактерій вироблення цитокіну G-CSF в мононуклеож з індукцією при інкубації зі штамом 35624.

Приклад 7. Вплив AH121A на вироблення цитокінів в дендритних клітинах

Резюме

Імунна відповідь є ретельно регульованим процесом, який при нормальній його роботі забезпечує захист від інфекцій та толерантність до нешкідливим антигенів середовища. Однак при запаленнях надмірно активоване імунну відповідь призводить до хронічного провоспалительному станом, що характеризується активацією вродженого імунітету та зростання субпопуляції поляризованих Т-клітин. В даний час лікування запальних захворювань сконцентровано на придушенні ключових медіаторів запалення, тобто популяцій запальних клітин. Однак використання такого підходу забезпечує лише тимчасове придушення симптомів запалення. Успішне лікування або профілактика, забезпечують довгострокове зняття симптомів запалення, можуть бути досягнуті тільки активізацією регуляторних процесів в клітинах, які захищають організм від руйнуючих його прозапальних реакцій. Bifidobacterium AH121A є пробіотичними мікроорганізмами, селективно стимулюють вироблення IL-10 в системі вродженого імунітету (тобто в дендритних клітинах) і індукують поляризацію Foxp-3+регулятор аберантної запальної реакції.

Регуляторні Т-клітини (Treg-клітини)

Основна роль регуляторних Т-клітин (Treg-клітин), що полягає в підтримці імунної толерантності, була продемонстрована в ряді моделей на тваринах, у яких адоптивное введення Treg-клітин, або навмисне збільшення популяції Treg-клітин сприяло запобігання або лікування ряду захворювань, провокованих Т-клітинами, включаючи алергію, астматичні запальне захворювання легень, аутоімунні хвороби і відторгнення алотрансплантата, за рахунок відновлення толерантності до алергенів, ауто-антигенів і алло-антигенів [8]. Описано безліч механізмів придушення імунітету, медіатором яких є Treg-клітини, в яких особливу роль відіграє вироблення IL-10 [9]. Відсутність або неправильне функціонування Treg-клітин корелює також з синдромом підвищення рівня IgE, гиперэозинофилией і аутоімунними станами людини, в той час як присутність Treg-клітин корелює з імунною толерантністю [10]. Дослідження механізмів, за допомогою яких імунна відповідь на не патологічні антигени в одних випадках веде до алергії, а в інших - до нешкідливого імунної відповіді, показали, що Treg�ок у здорових людей [11, 12]. Повторюється вплив антигенів бджолиної отрути на здорових, не страждають алергією бджолярів під час сезону медозбору являє собою цінну модель in vivo, що дозволяє підтвердити механізми імунної толерантності до антигенів бджолиної отрути [13]. Після множинних укусів бджіл специфічні до антигенів бджолиної отрути TH1 - і TH2-клітини перетворюються в TR1-клітини, що виробляють IL-10. Це відбувається паралельно з зниженням шкірної реакції на алергени пізньої фази та інгібуванням алерген-специфічних TH1 - і TH2-клітин. Ці процеси відбуваються, поки зберігається вплив на бджоляра бджолиної отрути, а через 2-3 місяці після закінчення сезону медозбору рівні експресії відповідних клітин повертаються на початковий рівень.

В даний час досліджуються різні стратегії стимулювання роботи Treg-клітин in vivo. Такі стратегії включають адоптивний перенесення індукованих або конститутивних Treg-клітин і їх стимулювання специфічними адъювантами або імуномодуляторами. Дані підходи виглядають більш привабливими в порівнянні з традиційними методами лікування, так як пригнічення активності антиген-специфічних Treg-клетокулирование імунітету in vivo. Більш того, можливе індивідуальне (специфічне) лікування пацієнтів при мінімумі побічних ефектів. Багато імуномодулятори, розроблені недавно або розробляються в даний час, такі як рапамицин, абатацепт (блокатор з-стимуляції CD80/CD86:CD28, пропонований Orencia), не-митогенние анти-CD3 моноклональні антитіла, моноклональні антитіла, що розщеплюють Т-клітини і спрямовані проти фактора некрозу пухлин TNF-α - надають пряме чи непряме вплив на Treg-клітини у вигляді стимулювання або придушення їх функцій [14-18]. Дослідження на мишах показали селективну доцільність збільшення популяції Treg-клітин, які націлені на орган (або лімфовузли, видаляють лімфу з даного органу) за рахунок впізнавання алергену або ауто-антигену, експресованого в запаленому органі [19]. Таким чином, перенесення орган-специфічних Treg-клітин може бути ефективний при придушенні поточного захворювання, і при цьому переносяться Treg-клітини не обов'язково повинні розпізнавати в точності той же антиген, що ауто-агресивні ефекторні Т-клітини [20]. Це має прямі наслідки на стратегії лікування, націлені на механізм імунної толерантності до алергенів, ауто-антигенів і sub>-клітин або низькомолекулярних сполук, стимулюючих Treg-клітини в тканинах, в даний час досліджуються [19], однак про подвійних сліпих дослідженнях з плацебо-контролем поки не повідомлялося. На даний момент єдино застосовуваним антиген-специфічним підходом, що забезпечує активацію вироблення Treg-клітин у людини, є метод придушення ініціації транскрипції (алерген-SIT). Алерген-SIT активує Treg-клітини і TR1-клітини, і схоже, що лікування з адренергічними антагоністами β2 підвищує кількість і активність даного типу клітин [21-23]. Нещодавно повідомлялося про істотних елементах транскрипції, що регулюють експресію промотору Foxp3, і вони напевно стануть новими цілями при розробці нових методів лікування [24, 25]

Мікроби як нові методи лікування

Інтерес до навмисного призначенням мікроорганізмів або продуктів їх метаболізму для лікування аберантної запальної активності набирає обертів. Типові мікроорганізми, досліджувані в даний час, містять біфідобактерії, лактобацили, не патогенні штами Е. coli та бактероїдів [26-31]. Захисний ефект, асоційований з даними мікроорганізмами, ймовірно, забезпечується безліччю механізмів, в яких ущается останнім часом, - це їхня загальна здатність активувати Treg-клітини. Так, наприклад, дослідження на мишах показали, що симбіотичні мікроорганізми (пробіотичний коктейль VSL №3), які потрапляють у шлунково-кишковий тракт, сприяють розвитку Treg-клітин в слизовій оболонці, що призводить до зменшення запалення при коліті [32]. Крім того, споживання штаму Bifidobacterium infantis призводить до перетворень Treg-клітин і захищає від індукованої липополисахаридами активації NF-κВ in vivo, а Lactobacillus reuteri індукують Treg-клітини, що захищають від алергічних реакцій в дихальних шляхах у мишей [33, 34]. Treg-клітини виробляються в тимусе, але їх вироблення може індукуватися у периферійних органах, включаючи слизову оболонку кишечника [35, 36]. CD103-позитивні дендритні клітини в цілому відповідають за перетворення Treg-клітин за допомогою процесів, залежних від трансформівного фактора росту TGF-β та ретиноєвої кислоти [37, 38]. Схоже, що рушійною силою таких перетворень є специфічні фактори середовища шлунково-кишкового тракту, асоційовані з присутністю великої кількості симбіотичних мікроорганізмів. Малоймовірно, однак, що всі симбіотичні мікроорганізмів однаково ефективні і�біотичні мікроорганізми (Bifidobacterium longum АН 1206, Bifidobacterium breve АН1205 і Lactobacillus salivarius АН102), показало, що бактерії Bifidobacterium longum АН 1206 индуцировали Treg-клітини і захищали від припливу еозинофілів в легені і блокували індукцію сироваткового IgE [39]. Інші види бактерій в таких моделях не забезпечували ефективної індукції Treg-клітин і не могли захистити від алергічної реакції. Тому індукція Treg-клітин може розглядатися як критична характеристика здорової мікробіоти, що захищає організм від можливого розвитку аберантної імунологічної реакції на потенційні алергени. На додаток до використання живих мікроорганізмів для лікування від алергії ще одним цікавим підходом є визначення мікробних чинників, відповідальних за сприятливий ефект, що забезпечується цими мікроорганізмами, і використання лише таких виділених факторів. Так, наприклад, полісахарид А, виділений з Bacteroides fragilis, сприяє досягненню належного балансу TH1/TH2 в дендритних клітинах слизової оболонки кишечника у мишей, не містить мікробів, а також, як показано в дослідженнях на тварин, сприяє захисту від коліту за рахунок вироблення IL-10 у CD4-позитивних Т-клітинах [29, 40]. Продовжуються пошуки нов�але також дозволять знайти нові молекули, володіють лікувальними властивостями.

Диференціація та дозрівання дендритних клітин

Людські моноцити виділяли з крові за допомогою методу, який представляв собою поєднання поділ по щільності центрифугуванням (Ficoll) і поділ клітин за допомогою магнітних микробусин, покритих CD14-специфічними антитілами (MiltentyiBiotec). Чистота виділеної фракції CD14+клітин була вище 90% у всіх експериментах. Для отримання незрілих дендритних клітин (iDC), очищені CD14+клітини вирощували протягом 5 днів у присутності IL-4 (R&D systems) і GM-CFS (R&D systems), так щоб вони диференціювалися мієлоїдний дендритні клітини (MDDC). На шостий день частина клітин не піддавалася стимуляції, частина стимулювали липополисахаридами (в кількості 1 мг/мл), і 5×105клітин MDDC стимулювали бактеріальними клітинами (в різній кількості) протягом 24 годин. Зокрема, проводили стимуляцію клітинами штаму В longum AH121A у пропорції 10:1 (бактерії/клітини, тобто 5×106бактерій), і в пропорції 1:1 (бактерії/клітини, тобто 5×105бактерій) протягом 24 годин. Як і очікувалося, із-за додавання антибіотика росту бактерій протягом даного періоду не спостерігалося. Виділяли супернатанти і аналізували їх на сох спільне вирощування з дендритними клітинами

Мононуклеари периферичної крові виділяли центрифугуванням лейкоцитарних плівок в градієнтах Lymphoprep. CD4-позитивних Т-клітини відокремлювали шляхом негативного відбору на колонці для афінної хроматографії виробництва R&D Systems, у відповідності з інструкціями виробника. Після поділу Т-клітини промивали і ресуспендували в середовищі RPMI 1640 для культур з додаванням 10% ембріональної бичачої сироватки, інактивованої нагріванням, 100 МО/мл пеніциліну і 100 мкг/мл стрептоміцину і 3 ммоль/л L-глютаміна. Очищені CD4+Т-клітини (1×106/мл) стимулювали поєднанням моноклональних антитіл: іммобілізованих анти-CDS (1 мкг/мл) і розчинних aHTH-CD28 (5 мкг/мл) (виробництва Pharmingen). Після цього очищені CD4+Т-клітини інкубували з дендритним клітинами, отриманими, як описано вище. Через 48 годин CD4+T-клітини пермибилизировали і фарбували на CD25 і Foxp-3. Після цього проводили аналіз клітин методом проточної цитометрії.

Результати показують, що дендритні клітини, будучи стимульовані бактеріями AH121A, запускають поляризацію та/або експансію популяції Treg-клітин, яка экспрессирует CD25 і Foxp-3.

Пробіотики володіють різною здатністю індукувати вироблення цитокінів дего впливу ми проаналізували вироблення IL-12p70 та IL-10 в мієлоїдних дендритних клітинах через 24 години після їх обробки бактеріями, як описано вище. Ліпополісахариди були сильними індукторами всіх типів досліджуваних цитокінів, у той час як AH121A индуцировали вироблення різних цитокінів в різній мірі (фіг.15). Так, наприклад, бактерії AH121A индуцировали менші рівні IL-10 у порівнянні з липополисахаридами, і не индуцировали вироблення IL-12p70 на обнаружимом рівні. Тобто, бактерії AH121A володіють потенційною здатністю до зменшення запалення.

Різниця у виробленні цитокінів відображає різну здатність до поляризації Т-клітин

Вироблення певних типів цитокінів дендритними клітинами важлива для запуску поляризації Т-клітин в бік Th1, Th2, Thl7 або Treg-клітин. Враховуючи різницю в рівнях виробляються цитокінів, ми додатково досліджували, мають мієлоїдний дендритні клітини, стимулюють AH121A, здатністю індукувати Foxp3+Treg-клітини. Дендритні клітини інкубували з AH121A протягом 5 днів, і після цього спільно вирощували з неподверженними аллогенам CD4+Т-клітинами. Після цього аналізували популяцію CD4+Foxp3+Treg-клітин методом сортування клітин з порушенням флуоресценції. Результати показують, що дендритні клітини, стимулюють бактеріями AH до висновку, що бактерії AH121A виробляли толерогенние дендритні клітини, які, в свою чергу, индуцировали вироблення CD4+Foxp3+Treg-клітин. Дійсно, ми показали, що мієлоїдний дендритні клітини, вирощені з AH121A, перетворювали CD4+CD25-Т-клітини CD4+CD25'Foxp3+Т-клітини. Тобто, бактерії AH121A володіють сильним імуномодулюючою дією, так як вони регулюють у бік підвищення вироблення Treg-клітин миелоидними дендритними клітинами in vivo. Отримані результати свідчать про вироблення CD4+CD25"Foxp3+Treg-клітин при реакції на AH121A in vitro, і цей ефект може бути терапевтично корисний, так як він забезпечує модуляцію запальних імунних порушень in vivo (фіг.16).

Раніше було показано, що деякі пробіотики (наприклад, L. casei і L. reuteri) можуть індукувати розвиток Treg-клітин (32, 41, 42). Було показано, що Bifidobacterium АН1206 були медіатором потужній активації Treg-клітин у трьох модельних дослідженнях на тварин. Крім того, споживання Bifidobacterium АН1206 захищало від припливу еозинофілів в легені і блокувало індукцію сироваткового IgE. Можна стверджувати, що Treg-клітини відіграють важливу роль у регулюванні алерген-специфичя в легені і стічні лімфовузли, і можуть пригнічувати викликану алергенами еозинофілію дихальних шляхів, гиперсекретивность слизових оболонок і гіперчутливість дихальних шляхів (43-48).

Численні дослідження на людях і тваринах показують, що хвороба запаленого кишечника виникає від втрати толерантності до симбіотичне бактеріям. Дослідження Round і Mazmanian (49) показує, що PSA керує розвитком Treg-клітин при лікуванні і профілактиці коліту. Ці висновки відповідають результатам досліджень, в яких було показано, що вироблення IL-10 Foxp3+Т-клітинами важлива для толерантності на поверхнях слизових оболонок і для запобігання запалення кишечника (49, 50).

Приклад 8. Приклади складів

Нижче наводяться приклади складів у вигляді сухих гранул, що містять пробіотичні біфідобактерії у відповідності з цим винаходом.

ІнгредієнтиЧастка у відсотках за вагою
Приклад 1Приклад 2Приклад 3Приклад 4
Зерна злак�nter">до 100
Побічні продукти пташині43,5404535
Жир пташиний1,281,021,161,35
Продукти з яєць2,42,12,52,2
Печінка куряча1,01,01,01,0
Дріжджі сухі пивні1,01.01,01,0
Мононатрийфосфат1,01,01,01,0
Кальцію карбонат0,80,80,80,8
Хлорид до"1">0,6
Вітаміни0,40,40,40,4
Холін-хлорид0,30,30,30,3
Мінерали0,30,30,30,3
DL-метіонін0,10,10,10,1
Хлорид натрію0,030,030,030,03
Пробіотик (1×1010KOE/р NCIMB 41675 в соняшниковій олії)10,5-0,6
Пробіотик (1×1010КУО/г NCIMB 41675 в соняшниковій олії)0,510,4

ІнгредієнтиЧастка у відсотках за вагою
Приклад 5Приклад 6Приклад 7
Водадо 38до 47до 50
Печінка курячадо 25до 20до 15
Продукти курячі252020
Рис пивоварний5710
Продукти з яєць32,51,5
Жир курячий2,93,03,2
Курячий бульйон0,60,70,10,1
Вітаміни0,050,10,1
Мінерали0,050,10,1
Пробіотик (1×1010KOE/р456
NCIMB41675)

Нижче наводяться приклади сумішей для приготування харчових добавок у вигляді йогурту, містить пробіотичні бактерії Bifidobacteria longum у відповідності з цим винаходом.

ІнгредієнтиЧастка у відсотках за вагою
Приклад 8Приклад 9Приклад 10
Молоко384248
Цукор1,00,80,8
Пребіотик0,250,30,5
Пробіотик (1×1010КУО/г NCIMB41675)456

Незважаючи на те, що в даному документі ілюструються і описуються конкретні втілення цього винаходу, досвідченим в даній області техніки буде очевидно, що можливе внесення інших змін і модифікацій, що не порушують ідею і призначення винаходу. З цією метою малося на увазі, що додається формулі винаходу представити всі можливі такі зміни і модифікації в обсязі цього винаходу.

Посилання

1. McCracken V. J. and Gaskins H. R. Probiotics and the immune system. In: Probiotics a critical review, Tannock, GW (ed). Horizon Scientific Press, UK. 1999, p.85-1 13.

2. Savage D. C. Interaction between the host and its microbes. In: Microbial Ecology of the Gut, dark and Bauchop (eds), Academic Press, London. 1977, p.277-310.

3. Kagnoff M. F. Immunology of the intestinal tract. Gastroenterol. 1993; 105 (5): 1275-80.

4. Lamm M. E. Interaction of antigens antibodies and at mucosal surfaces. Ann. Rev. Microbiol. 1997; 51: 31 1-40.

5. Raychaudhuri S., Rock KL. Fully mobilizing host defense: building better vaccines. Nat biotechnol, 1998; 16: 1025-31.

6. Tomomacolonic microflora (2001) Am. J. Vet. Res. 61(4): 609-615.

8. Sakaguchi S, Yamaguchi T, Nomura T, Ono M. Regulatory Т cells and immune tolerance. Cell 2008; 133: 775-87.

9. Taylor A, Akdis M, Joss A, Akkoc T, Wenig R, Colonna M, Daigle I, Flory E, Blaser K, Akdis CA. IL-10 inhibits CD28 and ICOS costimulations of T cells via src гомології 2 domain-containing protein tyrosine phosphatase 1. J Allergy din Immunol 2007; 120: 76-83.

10. Chatila ТА. Role of regulatory T cells in human diseases. J Allergy din Immunol 2005; 1 16: 949-59.

11. Akdis M. Healthy immune response to allergens: T regulatory cells and more. Curr Opin Immunol 2006; 18: 738-44.

12. Akdis M, Verhagen J, Taylor A, Karamloo F, Karagiannidis C, Crameri R, Thunberg S, Deniz G, Valenta R, Fiebig H, Kegel C, Disch R, Schmidt-Weber CB, Blaser K, Akdis CA. Immune responses in healthy and allergic Individuals are characterized by a fine balance between allergen-specific T regulatory 1 and T helper 2 cells. J Exp Med 2004; 199: 1567-75.

13. Meiler F, Zumkehr J, Klunker S, Ruckert B, Akdis CA, Akdis M. In vivo switch to IL-10-secreting T regulatory cells in high dose allergen exposure. J Exp Med 2008; 205; 2887-98.

14. Hendrikx TK, Velthuis JH, Klepper M, van Gurp E, Geel A, Schoordijk W, Baan CC, Weimar W. Monotherapy rapamycin allows an increase of CD4+ і CD25(bright+)FoxP3(+) T cells in renal recipients. Transpl Int 2009; 22: 884-91.

15. Kremer JM, Dougados M, Emery P, Durez P, Sibilia J, Shergy W, Steinfeld S, Tindall E, Becker JC, Li T, Nuamah IF, Aranda R, Moreland LW. Treatment of rheumatoid arthritis with the selective costimulation modulator abatacept: twelven month results of a phase iib, double-blind, randomized, placebo-controlled trial. Arthritis Rheum 2005; 52: 2263-71.

16. Utset TO, Auger JA, Peace D, Zivin RA, Xu D, Jolliffe L, Alegre ML, Bluestone JA, dark MR. Modified anti-CD3 therapy in psoriatic arthritis: a phase 1/П clinical trial. J Rheumatol 2002; 29: 1907-13.

17. Isaacs JD, Greer S, Sharma S, Symmons D, Smith M, Johnston J, Waldmann H, Hale G, Hazleman BL. Morbidity and mortality in rheumatoid arthritis patients with prolonged and� cells in rheumatoid arthritis and reversal by anti-TNF-a therapy. JExp Med 2004; 200: 277-85.

19. O'connor RA, Anderton SM. Multi-faceted control of autoaggression: Foxp3+regulatory Т cells in murine models of organ-specific autoimmune disease. Cell Immunol 2008; 251: 8-18.

20. Roncarolo MG, Battaglia M. Regulatory T-cell immunotherapy for tolerance to self antigens and alloantigens in humans. Nature Rev Immunol 2007; 7: 585-98.

21. Peek EJ, Richards DF, Faith A, Lavender P, Lee TH, Corrigan CJ, Hawrylowicz CM. Interleukin-10-secreting "regulatory" Т cells induced by glucocorticoids and beta2D agonists. Am J Respir Cell Mol Товарbiol 2005; 33: 105-11.

22. Karagiannidis, Akdis M, Holopainen P, Woolley NJ, Hense G, Riickert B, Mantel PY, Menz G, Akdis CA, Blaser K, Schmidt - Weber CB. Glucocorticoids upregulate FOXP3 expression and regulatory Т cells in asthma. J Allergy Clin Immunol 2004; 1 14: 1425-33.

23. Akdis M, Akdis CA. Mechanisms of allergenspecific immunotherapy. J Allergy Clin Immunol 2007; 1 19: 780-91.

24. Klunker S, Chong MM, Mantel PY, Palomares 0, Bassin C, Ziegler M, Riickert B, Meiler F, Akdis M, Liftman DR, Akdis CA. Transcription factors RUNX1 and RUNX3 in the induction and suppressive function of Foxp3+ inducible regulatory Т cells. J Exp Med 2009; 206: 2701-15.

25. Mantel PY, Kuipers H, Boyman 0, Rhyner C, Ouaked N, Riickert B, Karagiannidis C, Lambrecht BN, Hendriks RW, Crameri R, Akdis CA, Blaser K, Schmidt-Weber CB. GAT A3-driven Th2 responses inhibit TGF-β 1-induced FOXP3 expression and the formation of regulatory Т cells. PLoS Товарbiol 2007; 5: e329.

26. van der Kleij H, O Mahony C, Shanahan F, O Mahony L, Bienenstock J. Protective effects of Lactobacillus reuteri and Bifidobacterium infantis in murine models for colitis do not іnvolve the vagus nerve. Am J Physiol Regul Integr Comp Physiol 2008; 295: 1131-7.

27. Sheil B, McCarthy J, O Mahony L, Bennett MW, Ryan P, Fitzgibbon JJ, Kiely B, Collins JK, Shanahan F. Is the mucosal route of administration essential for probiotic function? Subcutaneous administration is associated with attenuation of murine colitis and arthritis. Gut 2004; 53: 694-700.

28. McCarthy J, O Mahony L, ckout mice and mechanistic link with cytokine balance. Gut 2003; 52: 975-80.

29. O Mahony L, Feeney M, o'halloran S, Murphy L, Kiely B, Fitzgibbon J, Lee G, O Sullivan G, Shanahan F, Collins JK. Probiotic impact on microbial flora, inflammation and tumour development in IL-10 knockout mice. Aliment Pharmacol Ther 2001; 15: 1219-25.

30. Mazmanian SK, Round JL, Kasper DL. A microbial symbiosis factor prevents intestinal inflammatory disease. Nature 2008; 453: 620-5.

31. Grabig A, Paclik D, Guzy C, Dankof A, Baumgart DC, Erckenbrecht J, Raupach B, Sonnenbom U, Eckert J, Schumann RR, Wiedenmann B, Dignass AU, Sturm A. Escherichia coli strain Nissle 1917 ameliorates experimental colitis via toll-like рецепторів 2-and toll-like рецепторів 4-dependent pathways. Infect Immun 2006; 74: 4075-82.

32. Di Giacinto C, Marinaro M, Sanchez M, Strober W, Boirivant M. Probiotics Ameliorate Recurrent Th1-Mediated Murine Colitis by Inducing IL-10 and IL-10-Dependent TGF-P Bearing Regulatory Cells. JImmunol 2005; 174: 3237-46.

33. O Mahony C, Scully P, O Mahony D, Murphy S, o'brien F, Lyons A, Sherlock G, MacSharry J, Kiely B, Shanahan F, O Mahony L. Commensal-Induced Regulatory Т Cells Mediate Protection against Pathogen-Stimulated NF-κВ Activation. PLOS Pathogens 2008; 4: е1000112.

34. Karimi K, Inman MD, Bienenstock J, Форсайта P. Lactobacillus reuteri-induced regulatory Т cells protect against an allergic airway response in mice. Am J Respir Crit Med Care 2009; 179: 186-93.

35. Karim M, Kingsley CI, Bushell AR, Sawitzki BS, Wood KJ. Alloantigen-induced CD25+CD4+ regulatory Т cells can develop in vivo from CD25-CD4+ precursors in a thymus independent process. J Immunol 2004; 172: 923-8.

36. Chen W, Jin W, Hardegen N, Lei KJ, Li L, Marines N, McGrady G, Wahl SM. Conversion of peripheral CD4+CD25+naive Т cells to CD4+CD25+regulatory Т cells by TGF-P induction of transcription factor Foxp3. JExp Med 2003; 198: 1875-86.

37. Coombes JL, Siddiqui KR, Arancibia-Carcamo CV, Hall J, Sun CM, Belkaid Y, Powrie F. A functionally specialized population ofmucosal CD 103+DCs induces Foxp3+ regulatory T cells via a TGF-p mote de novo generation of Foxp3 T reg cells via retinoic acid. J Exp Med 2007: 204: 1775-85.

39. Lyons A, O Mahony D, o'brien F, MacSharry J, Sheil B, Ceddia M, Russell WM, Форсайта P, Bienenstock J, Kiely B, Shanahan F, O Mahony L. Bacterial strain-specific induction of Foxp3+T regulatory cells is protective in murine allergy models, din Exp Allergy 2009; in press.

40. Mazmanian SK, Liu CH, Tzianabos АТ, Kasper DL. An immunomodulatory molecule of symbiotic bacteria directs maturation of the host immune system. Cell 2005; 122: 107-18.

41. Foligne B, Zoumpopoulou G, DewulfJ, Ben Younes A, Chareyre F, et al. (2007) A key role of dendritic cells in probiotic functionality. PLoS ONE 2: e313.

42. Smits HH, Engering A, van der Kleij D, de Jong EC', Schipper K, et al. (2005) Selective probiotic bacteria induce IL-10-producing regulatory T cells in vitro by modulating dendritic cell function through dendritic cell-specific intercellular adhesion molecule 3-grabbing nonintegrin. J Allergy din Immunol 115: 1260-1267.

43. Zuany-Amorim, Sawicka E, Manlius З et al. Suppression of airway eosinophilia killed by mycobacterium vaccae induced allergen-specific regulatory T-cells. Nat Med 2002; 8: 625-9.

44. Витоків MD, Benson RA, De Vries A, Fitch PM, Howie SE. Resolution of Der pi-induced allergic airway inflammation is dependent on CD4+CD25+Foxp3+regulatory cells. JImmunol 2007; 179: 7050-8.

45. McGlade JP, German S, Zosky GR et al. Suppression of the asthmatic phenotype by ultraviolet b-induced, antigen-specific regulatory cells, din Exp Allergy 2007; 37: 1267-76.

46. Strickland DH, Stumbles PA, Zosky GR et al. Reversal of airway hyperresponsiveness by induction of airway mucosal CD4+CD25+regulatory Tcells. J Exp Med 2006; 203: 2649-60.

47. Wu, Bi Y, Sun, Xia J, Wang Y, Wang C. Suppression of allergic inflammation by allergen-DNA-modified dendritic cells depends on the induction of Foxp3+regulatory T cells. Scand J Immunol 2008; 67: 140-51.

48. Boudousquie, Pellaton, Barbier N, Spertini F. CD4+CD25+Т cell depletion impairs tolerance inducobiota. Proc Nati Acad Sci USA. Jul 2010 6; 107(27): 12204-9.

50. Rubtsov YP, et al. Regulatory Т cell-derived interleukin-10 limits inflammation at environmental interfaces. Immunity. 2008; 28: 546-558.

1. Виділений штам Bifidobacterium longum AH121A, депонований у NCIMB під номером доступу 41675, придатний для застосування в імуномодуляції, індукції продукції цитокінів, лікуванні аутоімунного захворювань і контролі відносини IL-10:IL-12.

2. Штам Bifidobacterium longum за п. 1, який відрізняється тим, що він знаходиться у формі життєздатних клітин.

3. Штам Bifidobacterium longum за п. 1, який відрізняється тим, що він знаходиться у формі нежиттєздатних клітин.

4. Штам Bifidobacterium longum за п. 1, який відрізняється тим, що він виділений з отриманого методом біопсії зразка тканини товстої кишки тварини сімейства котячих.

5. Штам Bifidobacterium longum за п. 1, який відрізняється тим, що він володіє значним иммуномодулирущим дією при оральному споживанні.

6. Штам Bifidobacterium longum по кожному з пп.1-5, відрізняється тим, що він призначений для використання в якості лікарського засобу.

7. Штам Bifidobacterium longum по кожному з пп.1-5, відрізняється тим, що він призначений для використання при профілактиці і/або лікування небажаних запальних процесів.

8. Штам Bifidobacterium longum по кожному з пп.1-5, відрізняється тим, що він міцно-кишковому тракті.

9. Штам Bifidobacterium longum по кожному з пп.1-5, відрізняється тим, що він призначений для використання при профілактиці і/або лікуванні аутоімунних порушень, викликаних небажаними запальними процесами.

10. Штам Bifidobacterium longum по кожному з пп.1-5, відрізняється тим, що він призначений для використання при профілактиці і/або лікуванні діарейних станів, викликаних небажаними запальними процесами.

11. Штам Bifidobacterium longum по кожному з пп.1-5, відрізняється тим, що він призначений для використання при корекції або поліпшення роботи імунної системи тварин-компаньйонів.

12. Штам Bifidobacterium longum по кожному з пп.1-5, відрізняється тим, що він призначений для використання при профілактиці і/або лікуванні аутоімунних захворювань у тварин-компаньйонів.

13. Штам Bifidobacterium longum по кожному з пп.1-5, відрізняється тим, що він призначений для використання при профілактиці і/або лікуванні запалень у тварин-компаньйонів.

14. Склад, придатний для застосування в імуномодуляції, індукції продукції цитокінів і контролі відносини IL-10:IL-12, що містить штам Bifidobacterium longum по кожному з пп.1-5, а також один або більше інгредієнтів, вибраних з пробіотичного матеріалу, пребиотического ма матеріал.

16. Склад по кожному з пп.14 або 15, відрізняється тим, що він містить пребіотичний матеріал.

17. Склад по кожному з пп.14 або 15, відрізняється тим, що він містить носій для орального прийому.

18. Склад п. 17, відрізняється тим, що носій для перорального прийому є фармацевтично прийнятним носієм, таким як капсула, таблетка або порошок.

19. Склад п. 17, відрізняється тим, що носій для орального прийому обраний із сухих гранул, вологого корму для тварин, йогурту, масляної суспензії, суспензії на основі молока, сиру, складу на основі какао-масла, соусу і/або складу на основі йогурту і будь-яких їх комбінацій.

20. Продукт харчування, що містить штам Bifidobacterium longum по кожному з пп.1-5 або складу по кожному з пп.14-19.

21. Продукт харчування по п. 20, відрізняється тим, що він є сухим продуктом харчування.

22. Продукт харчування по п. 20, відрізняється тим, що він є вологим продуктом харчування.

23. Продукт харчування по кожному з пп.20-22, відрізняється тим, що він додатково містить пробіотичний матеріал.

24. Продукт харчування по кожному з пп.20-22, відрізняється тим, що він додатково містить пребіотичний матеріал.

25. Продукт харчування по кожному з пп.12-14, що відрізняє

 

Схожі патенти:

Спосіб отримання пробіотичного препарату для годівлі великої рогатої худоби м'ясних порід

Винахід відноситься до галузі біотехнології. Запропоновано спосіб отримання пробіотичного препарату іммобілізованих біфідобактерій для годівлі великої рогатої худоби м'ясних порід. Біфідобактерії штаму Bifidobacterium longum вирощують на живильному середовищі до отримання биотитра 108-109 КУО/мл Живильне середовище отримують з використанням электроактивированной катодного води з pH 8-9 і редокс-потенціалом -400...-500 мВ і з додаванням стабілізатора - серину в кількості не менше 0,01 мас.%. Потім біфідобактерії спільно з компонентами живильного середовища мобілізують на энтеросорбенте поліфепан. Перевагою способу є поліпшення апетиту великої рогатої худоби, перетравності поживних речовин раціону, збільшення середньодобових приростів, стимулювання рубцевого травлення, нормалізація всіх видів обміну речовин, прискорення заселення шлунково-кишкового тракту нормальною мікрофлорою, зменшення виділення з фекаліями патогенних і умовно-патогенних бактерій. 4 табл., 2 пр.

Спосіб отримання аргініну з використанням corynebacterium glutamicum атсс 21831 або corynebacterium glutamicum атсс 21493 в ферментаційної середовищі, що містить в якості джерела вуглецю жом маніока або насіння джекфрута

Група винаходів відноситься до біотехнології. Запропоновані варіанти способу отримання аргініну за допомогою ферментації агропромислових відходів, у тому числі крохмаловмісних, з отриманням ферментованої рідини, що містить аргінін, і виділення аргініну з ферментованої рідини. Перед ферментацією може бути здійснено ферментативний гідроліз агропромислових відходів для перетворення відходів у відновлюючі цукри. Ферментацію здійснюють в аеробних умовах при pH 5,5-7,5, при температурі 27-36°C протягом від 1 до 10 днів у присутності Corynebacterium glutamicum ATCC 21831 або Corynebacterium glutamicum ATCC 21493. Як агропромислових відходів використовують жом, порошок насіння, жому маніоки і/або порошок насіння джекфрута. Група винаходів дозволяє отримати більш високий вихід аргініну. 2 н. і 18 з.п. ф-ли, 6 табл., 4 пр.

Живі вакцини аттенуйовані

Винаходи належать до галузі біотехнології і стосуються способу запобігання або лікування захворювання у суб'єкта, зумовленого патогенним організмом шляхом введення вакцини композиції, вакцини композиції та її застосування. Охарактеризована вакцинна композиція містить бактерії, аттенуйовані мутацією в гені, що кодує АВС-пептидний транспортерні білок ОppD, які можуть персистувати в суб'єкті. Зазначена мутація робить кодований АВС-пептидний транспортерні білок нефункціональним. Представлені винаходу можуть бути застосовні в імунології для отримання і застосування вакцин. 3 м. і 16 з.п. ф-ли, 10 іл., 21 табл., 5 пр.

Lactobacillus johnsonii la1 nсс533 (cncm 1-1225) та імунні порушення

Винахід відноситься до композиції для лікування або запобігання порушень, пов'язаних із зниженим рівнем дефензинов. Композиція містить від 0,005 до 1000 мг Lactobacillus johnsonii Lal (NCC533, № CNCM 1-1225) на щоденну дозу. Причому при температурі 110-140 протягом 5-30 з щонайменше 90% L. johnsonii Lal (NCC533, № CNCM 1-1225) переведені в стан, при якому вони стають нереплицирующимися. Винахід забезпечує посилення експресії мРНК дефензина hBD1. 4 з.п. ф-ли, 2 іл.

Ферментаційна середовище та спосіб отримання рекомбінантних білків

Винахід відноситься до біотехнології, а саме до ферментаційної середовищі і способу отримання рекомбінантних білків з використанням даного середовища. Ферментаційна середовище для отримання рекомбінантних білків, вибраних з групи, що включає Г-КСФ, стрептокиназу і ліпазу, з використанням мікроорганізмів, виділених з групи, що включає: E. Coli, Streptomyces sp. і Rhizomucor sp., характеризується підтримуваної концентрацією сечовини або її похідних в інтервалі від 0,5 г/л до 2 г/л. Середовище містить на літр води основні солі в наступних кількостях: ортофосфорну кислоту (85%) від 2,67 до 133,5 мл, сульфат кальцію від 0,093 до 4,65 м, сульфат калію від 1,82 до 91 м, сульфат магнію-7H2O від 1,49 до 74,5 г, гідроксид калію від 0,413 до 20,65 г, гліцерин від 4 до 200 р. Середовище містить на літр води мікроелементи в наступних кількостях: сульфат міді-5H2O від 0,6 до 30 м, йодид натрію від 0,008 до 0,4 г, сульфат марганцю-H2O від 0,3 до 15 м, модібдат натрію-H2O від 0,02 до 1 м, борна кислота від 0,002 до 0,1 г, хлорид кобальту від 0,05 до 2,5 г, хлорид цинку від 2 до 100 м, сульфат заліза двовалентного-7H2O від 6,5 до 325 м, біотин від 0,02 до 1 м, сірчану кислоту від 0,5 до 25 мл Винахід забезпечує підвищений вихід цільових продуктів. 2 н. і 4 з.п. ф-ли, 27 іл., 3 табл., 16 пр.

Штам бактерії bacillus subtilis - високоактивний продуцент пектолитических ферментів, мацерирующих рослинну тканину

Винахід відноситься до мікробіологічної промисловості. Запропоновано штам бактерії Bacillus subtilis ВКПМ B-11964 - високоактивний продуцент пектолитических ферментів, мацерирующих рослинну тканину. Даний штам проявляє високі пектат-лиазную і пектин-лиазную активності по відношенню до пектинам з різних джерел. 2 табл., 5 пр.

Штам bacillus sp. для біологічної боротьби з saprolegnia sp. і його застосування

Група винаходів відноситься до галузі біотехнології і мікробіології. Запропоновано штам Bacillus sp. КССМ11143Р, володіє протигрибковою активністю щодо Saprolegnia sp., культуральна рідина, одержаний при культивуванні штаму, пробіотична композиція, кормова добавка, протигрибковий засіб і засіб для поліпшення якості води, що містять штам Bacillus sp. КССМ11143Р або його культуральну рідину. Також запропоновано спосіб культивування риби або ракоподібних, спосіб запобігання сапролегниоза у тварин і спосіб поліпшення якості води з використанням штаму Bacillus sp. КССМ11143Р або його культуральної рідини. Штам Bacillus sp. КССМ11143Р має високий рівень продуктивності сидерофоров з проявом високої здатності захоплення заліза, і таким чином інгібує ріст інших патогенних бактерій і Saprolegnia sp., сприяє збільшенню швидкості споживання їжі рибою і швидкості збільшення ваги, а також зниження рівня екскреції, що призводить до поліпшення якості води. 9 н. і 1 з.п. ф-ли, 4 іл., 11 табл., 15 пр.

Штам microbacterium species для очищення прісноводних водойм та їх донних відкладень від нафти і нафтопродуктів

Винахід відноситься до галузі біотехнології. Запропоновано штам Microbacterium species BKM Ac-2614D для очищення забруднених і хронічно забруднених прісноводних об'єктів в температурному діапазоні від +2ºC до +25ºC. Винахід дозволяє здійснювати очищення води і донних відкладень від нафтових вуглеводнів при низькій концентрації кисню у воді і в умовах високих широт. 3 табл., 2 пр.
Винахід відноситься до гідролізної промисловості, зокрема до способів очищення гідролізатів лігноцеллюлозного сировини від інгібіторів ацетонобутилового бродіння, і може бути використано при підготовці поживних середовищ для отримання біоетанолу, біобутанолу, ацетону. Спосіб включає обробку гідролізатів групою мікроорганізмів, причому в якості консорціуму мікроорганізмів використовується активний мул каналізаційних очисних споруд, попередньо адаптований до живильного субстрату на основі речовин, які інгібують ацетонобутиловое бродіння. Використовується активний мул міських каналізаційних очисних споруд, бактеріальна компонента якого представлена бактеріями родів Pseudomonas (64%), Bacillus (18%), Zooglea (7%), Micrococcus(5%), Chromobacterium (3%), Acinetobacter (2%), Citrobacter (1%). Також використовується активний мул каналізаційних очисних споруд свинарських підприємств, бактеріальна компонента якого представлена бактеріями родів Nocardia (35%), Rhodococcus (28%), Micrococcus (18%), Pseudomonas (13%), Bacillus (6%). Винахід дозволяє позбутися від інгібуючих факторів у процесі зброджування гідролізатів лігноцеллюлозного сировини, дозволяє уникнути корозії гідролізного обладнання, а також сприяє оптимиз

Штам бактерій pseudomonas aeruginosa для виготовлення вакцини проти псевдомонозу свиней

Винахід відноситься до біотехнології та ветеринарії. Штам бактерій Pseudomonas aeruginosa №6-ДЕП депонований у колекції ФГБУ ВГНКИ. Штам має високу імуногенну активність і призначений для виготовлення вакцини проти псевдомонозу свиней. При використанні вакцини на основі запропонованого штаму титр антитіл до соматичного антигену О6 Pseudomonas aeruginosa у сироватці крові кролів та свиней через 14 днів після останньої імунізації становить відповідно 1:819,2 і 1:1024. 3 табл., 4 пр.

Пептиди, які проникають у клітини, і їх застосування

Винахід відноситься до галузі біотехнології, конкретно до інтерналізації терапевтичних молекул всередину клітини, і може бути використане в медицині. Отримують композицію для доставки молекул нуклеїнових кислот в клітини, що містить щонайменше один пептид з щонайменше 92% ідентичністю до GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); або YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), приєднаний до однієї або кількох молекул нуклеїнових кислот. Винахід дозволяє підвищити ефективність доставки молекул нуклеїнових кислот всередину клітини ссавця за рахунок пептиду, здатного интернализироваться всередину клітини ссавця з ефективністю, що становить щонайменше 200% від ефективності інтерналізації пептиду ТАТ, має аминокислотную послідовність GRKKRRQRRRPPQ (SEQ ID NO: 1). 5 н. і 3 з.п. ф-ли, 16 іл., 1 табл., 8 пр.

Кристали

Кристали // 2556206
Винахід описує кристали 2-{4-[N-(5,6-дифенилпиразин-2-іл)-N-изопропиламино]бутилокси}-N-(метилсульфонил)ацетаміду ("з'єднання А"), у вигляді форми-I кристала сполуки А, яка демонструє піки дифракції при 9,4 градуси, 9,8 градуса, 17,2 градуси і 19,4 градуси в її спектрі порошкової рентгенівської дифракції, у вигляді форми-II кристала сполуки А, яка демонструє піки дифракції при 9,0 градусах, 12,9 градуси, 20,7 градуса і 22,6 градуси в її спектрі порошкової рентгенівської дифракції, і у вигляді форми-III кристала сполуки А, яка демонструє піки дифракції при 9,3 градуса, 9,7 градуси, 16,8 градуси, 20,6 градуси і 23,5 градуси в її спектрі порошкової рентгенівської дифракції. Також описуються способи отримання форм-I, II і III кристала сполуки А, фармацевтична композиція і агонистический агент щодо рецептора PGI2 на їх основі, прискорює агент при ангиогенной терапії, генної інженерії або аутоімунної трансплантації кісткового мозку та прискорює агент для ангіогенезу при відновленні периферичної артерії або при ангиогенной терапії на їх основі, а також описується профілактичне або терапевтичний засіб проти цілого ряду захворювань та станів. 11 н. п. ф-ли, 6 іл., 6 табл.,

Анти-ifnar1 антитіла зі зниженою спорідненістю з лігандом fc

Пропонований винахід відноситься до імунології. Запропоновано моноклональне анти-IFNAR1 антитіло з мутаціями L234F, L235E і P331S в області Fc людського IgG1, володіє зниженим спорідненістю щодо Fcgamma RI, Fcgamma RIIIА і c1q рецепторів порівняно з немодифікованим антитілом. Описана виділена нуклеїнова кислота, що забезпечує експресію зазначеного антитіла, яка кодує антитіло нуклеотидну послідовність, і фармацевтична композиція на основі зазначеного антитіла. Використання винаходу забезпечує антитіло із зниженою спорідненістю до рецепторів Fcgamma RI, Fcgamma RIIIА і c1q, що забезпечує зниження небажаних ефекторних функцій при лікуванні хронічного запалення та аутоімунних станів. 3 н. і 6 з.п. ф-ли, 34 іл., 7 табл., 36 пр.

Lactobacillus johnsonii la1 nсс533 (cncm 1-1225) та імунні порушення

Винахід відноситься до композиції для лікування або запобігання порушень, пов'язаних із зниженим рівнем дефензинов. Композиція містить від 0,005 до 1000 мг Lactobacillus johnsonii Lal (NCC533, № CNCM 1-1225) на щоденну дозу. Причому при температурі 110-140 протягом 5-30 з щонайменше 90% L. johnsonii Lal (NCC533, № CNCM 1-1225) переведені в стан, при якому вони стають нереплицирующимися. Винахід забезпечує посилення експресії мРНК дефензина hBD1. 4 з.п. ф-ли, 2 іл.

N-вмісні гетероарильние похідні в якості інгібіторів jak3 кінази

Винахід відноситься до нових N-вмісних гетероарильним похідним формули I або II або їх фармацевтично прийнятним солей, які мають властивості інгібіторів кінази JAK, зокрема JAK3, і можуть знайти застосування для лікування таких захворювань, як астма і хронічне обструктивне захворювання легенів (COPD). У формулах I або II А являє собою вуглець і являє собою азот або А являє собою азот і являє собою вуглець; W являє собою СН або N; R1 і R2, незалежно, являють собою водень, С1-4алкил, галогенС1-4алкил, -CN; R3 являє собою С1-4алкил, R9-Cl-4алкил, Cy1, де Cy1 необов'язково заміщений одним або декількома заступниками R10; R4 являє собою водень, С1-4алкил, Rl2R7N-С0алкил, де один з R7 і R12 являє собою водень, а інший являє собою С1-4алкил або групу R13, яку вибирають з С1-5алкила, Cy2-С0алкила; R5 являє собою водень; R6 являє собою водень, С1-4алкил, С1-4алкоксиС1-4алкил, гидроксиС1-4алкил, R12R7N-C1-4алкил, R16CO-С0алкил, Cy1; R7 являє собою водень або С1-4алкил; R9 являє собою галоген, -CN, -CONR7R12, -COR13, CO2R12, -OR12, -SO2R13, -SO2NR7R12, -NR7R12, -NR7COR12; R10 являє собою С1-4алкил або R9-С0-4алкил; R11 являє собою С1-4алкил, галоген, -CN, -NR7R14; R12 чи R14R7N-C1-4алкил; де Cy2 необов'язково заміщений одним або декількома заступниками R11; R14 являє собою водень або С1-4алкил; R16 являє собою С1-4алкил, галогенС1-4алкил, C1-4алкоксиС1-4алкил, гидроксиС1-4алкил або цианоС1-4алкил; Cy1 являє собою моноциклическое карбоциклическое ненасичених або насичене кільце, вибране з С3-С6циклоалкила, фенила, або насичене моноциклическое 4-6-членное гетероциклічна кільце, що містить від 1 до 2 гетероатомів, вибраних з N і S, або частково ненасичених 10-членное бициклическое гетероциклічна кільце, містить атом кисню в якості гетероатома, які можуть бути заміщені групою R11, де зазначене кільце пов'язане з іншою частиною молекули через будь-який доступний атом С, і де один або кілька кільцевих атомів С або S необов'язково окислені з утворенням СО або SO2; і Cy2 являє собою моноциклическое карбоциклическое насичене кільце, вибране з С3-С6циклоалкила, або ароматичне моноциклическое 4-6-членное гетероциклічна кільце, що містить від 1 до 2 гетероатомів, вибраних з N і S, або ненасичених 10-членное бициклическое гетероциклічна кільце, що містить атом кисню в якості гетероатома, які можуть бути заміщені гру. �-ли, 41 пр.

Варіанти crig з дозрілої аффинностью

Винахід відноситься до галузі біохімії, зокрема до варіантів CRIg з дозрілої аффинностью. Заявлений варіант CRIg, який є щонайменше в 2 рази більш сильним інгібітором альтернативного шляху активації комплементу, ніж CRIg людини з нативною послідовністю, і необов'язково володіє підвищеним щонайменше у 2 рази спорідненістю зв'язування з C3b. Також заявлені містять зазначений варіант CRIg химерна молекула і фармацевтична композиція. Варіант CRIg може застосовуватися для одержання лікарського засобу для лікування комплемент-асоційованого захворювання або стану. Винахід дозволяє поліпшити терапевтичну ефективність поліпептидів CRIg. 4 н. і 13 з.п. ф-ли, 17 іл., 4 табл., 1 пр.

Заміщення фосфорсодержащей групою хинолиноподобное з'єднання, спосіб його одержання, лікарська композиція, що містить це з'єднання, і його застосування

Винахід відноситься до заміщених фосфорсодержащей групою хінолінів формули (I), які можуть використовуватися в медицині , де Ζ являє собою , V1 і V2 незалежно обрані з водню або галогену; один з R і R` являє собою фосфорсодержащий заступник Q, інший вибраний з водню або метоксила; де фосфорсодержащий заступник Q являє собою , А представляє собою; L являє собою С1-6алкил; J являє собою NH або С3-6гетероциклоалкил і J можливо заміщений G3; X відсутня або являє собою-З(=O)-; Υ відсутня або являє собою C1-6алкил; кожен з R1 і R2 незалежно обраний С1-6алкила або С1-6алкокси; G3 являє собою С1-6алкил, R3S(=O)m-, R5C(=O)- або R3R4NC(=O)-; R3, R4 і R5 незалежно обрані з Η або С1-6алкила; m дорівнює 0-2. Запропоновано нові інгібітори протеїнкінази, ефективні для лікування захворювань, асоційованих з аномальною активністю протеїнкінази. 6 н. і 14 з.п. ф-ли, 42 пр., 8 табл., 3 іл.

Нові il-17-зв'язуючі сполуки та їх медичне застосування

Винахід відноситься до біотехнології, а саме до нових IL-17-інгібуючим поліпептидів, відповідним злитим білків, до композицій і застосування їх у медичних цілях. Поліпептид містить аминокислотную послідовність, яку вибирають із групи, що складається з GVTLFVALYD YKAFWPGDLS FHKGEKFQIL RTSDGDWWEA RSLTTGETGY IPSNYVAPVD SIQ (SEQ ID NO: 39), GVTLFVALYD YKAFWPGDIS FHKGEKFQIL RTSDGEWWVA RSLTTGEEGY IPSNYVAPVD SIQ (SEQ ID NO:57) або GVTLFVALYD YKAFWPGDIS FHKGEKFQIL RTSDGEWWIA RSLTTGEEGY IPSNYVAPVD SIQ (SEQ ID NO: 107); амінокислотної послідовності, що має, щонайменше, 80%, переважно, щонайменше, 90%, більш переважно, щонайменше, 95% ідентичність амінокислотної послідовності з SEQ ID NO: 39, SEQ ID NO:57 або SEQ ID NO: 107; фрагмента або похідного функціонального SEQ ID NO: 39, SEQ ID NO:57 або SEQ ID NO: 107, одержуваного за рахунок заміщення, додавання і видалення не більше ніж 5 амінокислот. Запропоноване винахід дозволяє з високою специфічністю і аффинностью пов'язувати IL-17. 12 н. і 21 з.п. ф-ли, 17 іл., 3 табл., 12 пр.

Анти-cemx антитіла, здатні зв'язуватися з mige людини в лімфоцитах

Винахід відноситься до галузі імунології. Розглянуто застосування пептиду з амінокислотною послідовністю GLAGGSAQSQRAPDRVL для відбору СεmX-специфічних антитіл і антигенсвязивающих таких фрагментів антитіл. Запропоновано СεmX-специфічне антитіло, а також спосіб, який передбачає відбір антитіл, специфічно зв'язують пептид щодо винаходу, і спосіб лікування захворювань, опосередкованих IgE, що включає введення суб'єкту антитіла щодо винаходу. Виявлено, що моноклональні антитіла, специфічно зв'язують сегмент СεmX GLAGGSAQSQRAPDRVL, можуть ефективно зв'язуватися з mIgE на людських В клітинах і придатні для спрямованого впливу на ці клітини для лікування захворювань, опосередкованих IgE. 4 н. і 10 з.п. ф-ли, 5 іл., 4 пр.

Анти-icos антитіла та їх застосування в лікуванні онкологічних, пов'язаних з трансплантацією та аутоімунних захворювань

Винахід відноситься до галузі імунології. Запропоновано виділене антитіло до білка ICOS людини з підвищеною ефекторній функцією. Також описані клітка і спосіб отримання антитіла по справжньому винаходу, фармацевтична композиція, способи лікування аутоімунного захворювання або розлади, відторгнення трансплантата і злоякісності Т-клітин у людини, а також спосіб виснаження ICOS-експресують Т-клітин, спосіб руйнування структури зародкового центру у вторинному лимфоидном органі примату, способи виснаження В-клітин зародкового центру вторинного лімфоїдного органу і циркулюючих В-клітин, які пройшли перемикання класу, у примату. Даний винахід може знайти подальше застосування в терапії захворювань, опосередкованих Т-клітинами. 14 н. і 19 з.п. ф-ли, 21 іл., 3 табл.

Спосіб отримання пробіотичного препарату для годівлі великої рогатої худоби м'ясних порід

Винахід відноситься до галузі біотехнології. Запропоновано спосіб отримання пробіотичного препарату іммобілізованих біфідобактерій для годівлі великої рогатої худоби м'ясних порід. Біфідобактерії штаму Bifidobacterium longum вирощують на живильному середовищі до отримання биотитра 108-109 КУО/мл Живильне середовище отримують з використанням электроактивированной катодного води з pH 8-9 і редокс-потенціалом -400...-500 мВ і з додаванням стабілізатора - серину в кількості не менше 0,01 мас.%. Потім біфідобактерії спільно з компонентами живильного середовища мобілізують на энтеросорбенте поліфепан. Перевагою способу є поліпшення апетиту великої рогатої худоби, перетравності поживних речовин раціону, збільшення середньодобових приростів, стимулювання рубцевого травлення, нормалізація всіх видів обміну речовин, прискорення заселення шлунково-кишкового тракту нормальною мікрофлорою, зменшення виділення з фекаліями патогенних і умовно-патогенних бактерій. 4 табл., 2 пр.
Up!