Інгібування axl сигналізації в антиметастатической терапії

 

Винахід заявляє про пріоритет Попередньої заявки США №61/336478, поданої 22 січня 2010 року, зміст якої включено тут в якості посилання.

Область техніки

Даний винахід відноситься до пухлинної інвазії та метастазування, наприклад, лікування або діагностики пухлинної інвазії і метастазування через шляхи, пов'язані з AXL та/або GAS6.

Рівень техніки

Інвазії і метастазування - найбільш підступні і небезпечні для життя аспекти раку. У той час як пухлини з мінімальною інвазією або взагалі неінвазивні можуть бути успішно видалені, після того, як пухлина стає інвазивної, вона може поширюватися через лімфатичні та/або судинні канали в кілька місць, і повне видалення стає дуже важким. Інвазії і метастазування знищують господаря через два процеси: локальну інвазію і віддалену колонізацію органів з їх пошкодженням. Локальна інвазія може призвести до порушення функції тканин від локального стиснення, локального руйнування або утруднення нормальної функції органу. Найбільш важливим поворотним пунктом в раку, однак, є розвиток віддалених метастазів. Пацієнт не може бути вилікуваний локальної терапією на цьому етапі.

Процесѹ господар-пухлина. Цей складний процес вимагає від клітин входу в кровоносну або лімфатичну систему, затримки на віддаленому ділянці судинного або лімфатичного русла, активного проникнення судин в інтерстиціальну тканину і паренхіму органу, а також розростання в якості вторинної колонії. Метастатичний потенціал залежить від місцевої мікросередовища, ангіогенезу, взаємодій строма - пухлина, вироблення цитокінів локальними тканинами, а також молекулярних фенотипів пухлини і клітин господаря.

Місцева початкова стадія інфільтруючого росту пухлини може статися рано, незважаючи на те, що віддалене поширення ще не очевидно, чи, можливо, ще не почалося. Пухлинні клітини проникають в епітеліальну базальну мембрану і входять в основну інтерстиціальну строму протягом переходу від in situ до інвазивної карциномі. Як тільки пухлинні клітини проникають в основну строму, вони отримують доступ до лімфатичних і кровоносних судинах для віддаленого поширення при вивільненні фрагментів матриксу та факторів росту. При переході від доброякісної пухлини до інвазивної карциномі відбуваються загальні та широкомасштабні зміни в організації, розподіл і кількості эпителиалточени на рівні сигнальних шляхів або селективних модулюючих білків. Активність протеїнкінази, гомеостаз і активація онкобелка є керуючими сигналами і, отже, можуть грати ключову роль регуляторних ділянок для терапевтичного втручання. Кінази в сигнальних шляхах, що регулюють інвазію і ангіогенез, можуть бути важливим регулятором метастазування. Одним з найбільших класів біохімічних, молекулярних мішеней є сімейство рецепторів тирозинкінази (RTKs). Найбільш поширеними молекулярними мішенями, що відносяться до рецепторів тирозинкінази, на сьогоднішній день є рецептори EGF і васкулярного ендотеліального фактора росту (VEGF). Новітні киназние молекулярні мішені включають в себе тип III RTK сімейства c-kit і abl. Інгібітори цих молекул прописувалися в поєднанні з класичною хіміотерапією.

Метастази в кінцевому рахунку відповідальні за більшу частину страждань і смертності від раку. Існує необхідність ідентифікувати і молекулярні та функціональні маркери, які визначають метастатичні клітини раку і націлюватися на них, а також створювати реагенти для їх специфічного інгібування.

Публікації в цій області включають, зокрема, Li et al. Oncogene. (2009) 28(39):3442-55; Заявку на патент США, 20050186571 Ullrich et 17):2264-74; Koorstra et al. Cancer Товарbiol Ther. 2009 8(7):618-26; Tai et al. Oncogene. (2008) 27(29):4044-55.

Рецептор тирозинкінази AXL (також відомий як Ufo і Tyro7) належить до сімейства тирозинових рецепторів, яке включає в себе Tyro3 (Sky) і Mer (Tyrol 2). Загальним лігандом для сімейства AXL є GAS6 (Специфічно затримує зростання білок 6). AXL людини містить відкриту рамку зчитування 2682п.про. здатну направляти синтез 894-амінокислотного поліпептиду. Два варіанти мРНК були охарактеризовані, з варіантом 1 транскрипту можна ознайомитися у Genbank, за номером доступу NM_021913.3, а з варіантом 2 транскрипту можна ознайомитися за номером доступу NM_001699.4. Полипептидная послідовність нативного білка визначається як SEQ ID NO:1, а конкретна посилання може бути зроблена до послідовності з урахуванням амінокислотних модифікацій. Важливі функції клітинного GAS6/AXL включають клітинну адгезію, міграцію, фагоцитоз, і інгібування апоптозу. Сімейство рецепторів GAS6 і AXL суворо регульоване в тканинах і певним чином при хворобі.

AXL характеризується унікальною молекулярною структурою, яка полягає в тому, що внутрішньоклітинна область має типову структуру рецептора тирозинкінази, а позаклітинний домен містить мотиви фібронектину III і Ig, схожі на мовляв�про припускає, що цей RTK бере участь у розвитку мезенхіми і нервової системи. У дорослих експресія AXL низька, але в різних пухлинах експресія повертається до високих рівнів. GAS6 є поки що єдиним активуючу лігандом для AXL.

Рецептори тирозинкінази (RTK), як правило, активується лігандами, які сприяють дімерізаціі рецептора і, в свою чергу, аутофосфорілірованію залишків тирозину в цитозольном домені. Зв'язування сигнальних білків у цих фосфорильованих залишках тирозину призводить до подальшої передачі сигналу в сигнальному шляху. Сімейство AXL RTKs унікальне тим, що його члени активуються GAS6, членом сімейства вітамін К-залежних білків, які нагадують фактори згортання крові, а не типові чинники зростання.

Сутність винаходу

Даний винахід базується частково на відкритті того, що шляхи пов'язані з AXL та/або GAS6 пов'язані з інвазією пухлини і/або метастазуванням. Відповідно, даний винахід відноситься до композицій і способів, які використовуються для лікування пухлинної інвазії та/або метастазування, наприклад, за допомогою інгібування шляхів пов'язаних з AXL та/або GAS6. Крім того, даний винахід забезпечує реагенти і способи, які корисні �наприклад, за допомогою визначення рівня активності AXL та/або GAS6.

В одному з варіантів втілення цього винаходу пропонується розчинний варіант поліпептиду AXL, відрізняється тим, що поліпептид не має трансмембранного домену AXL та, необов'язково, внутрішньоклітинного домену, і містить, щонайменше, одну модифікацію амінокислоти в порівнянні з послідовністю AXL дикого типу, і де зазначені зміни підвищують спорідненість зв'язування поліпептиду AXL до GAS6. В деяких варіантах втілення розчинний варіант поліпептиду AXL містить, щонайменше, одну модифікацію амінокислоти в ділянці, обраний із групи, що складається з 1) між 15-50, 2) між 60-120 і 3) між 125-135 в послідовності AXL дикого типу (SEQ ID NO:1). В деяких інших варіантах втілення, розчинний варіант поліпептиду AXL містить, щонайменше, одну модифікацію амінокислоти в положенні 19, 23, 26, 27, 32, 33, 38, 44, 61, 65, 72, 74, 78, 79, 86, 87, 88, 90, 92, 97, 98, 105, 109, 112, 113, 116, 118, 127 чи 129 послідовності AXL дикого типу (SEQ ID NO:1), або їх поєднання. В деяких інших варіантах втілення розчинний варіант поліпептиду AXL містить, щонайменше, одну модифікацію амінокислоти, яка обрана з групи, що складається з 1) А19Т, 2) Т23М, 3) E26G, 4) E27G або E27K, 5) G32S, 6) N33S, , 3) 0109R, 24) V112A, 25) F113L, 26) H116R, 27) T118A, 28) G127R або G127E і 29) E129K і їх комбінації і консервативні еквіваленти.

В деяких інших варіантах втілення розчинний варіант поліпептиду AXL містить заміни амінокислот у порівнянні з послідовністю AXL дикого типу (SEQ ID NO:1) по наступних позиціях: а) гліцин 32; (b) аспарагінова кислота 87; (з) валін 92; і (d) гліцин 127. В деяких інших варіантах втілення розчинний варіант поліпептиду AXL містить такі зміни: залишок гліцину 32 замінений залишком серину, залишок аспарагінової кислоти 87 замінений залишком гліцину, залишок валіну 92 замінений залишком аланіну, або залишок гліцину 127 замінений залишком аргініну або їх комбінація, чи консервативний еквівалент. У ще кількох інших варіантах втілення розчинний варіант поліпептиду AXL містить заміни амінокислоти в порівнянні з послідовністю AXL дикого типу (SEQ ID NO:1) по наступних позиціях: а) глутамінова кислота 26; (b) валін 79; (з) валін 92; і (d) гліцин 127. У ще кількох інших варіантах втілення розчинний варіант поліпептиду AXL містить такі зміни: залишок глутамінової кислоти 26 замінений залишком гліцину, залишок валіну 79 замінений залишком метіоніну, залишок валіну 92 замінений остатк�м еквівалентом.

В деяких інших варіантах втілення розчинний варіант поліпептиду AXL містить, щонайменше, амінокислоти 1-437, 19-437, 130-437, 19-132, 1-132 поліпептиду AXL дикого типу (SEQ ID NO:1). У ще кількох інших варіантах втілення розчинний варіант поліпептиду AXL є гібридним білком, що містить область Fc.

В одному з варіантів втілення розчинний варіант поліпептиду AXL має спорідненість щонайменше 1×10-5М до GAS6. В іншому варіанті втілення розчинний варіант поліпептиду AXL має спорідненість щонайменше 1×10-6М, до GAS6. Ще В одному варіанті втілення розчинний варіант поліпептиду AXL має спорідненість щонайменше 1×10-7М до GAS6. Ще В одному варіанті розчинний варіант поліпептиду AXL має спорідненість щонайменше 1×10-8М до GAS6. Ще В одному варіанті втілення розчинний варіант поліпептиду AXL володіє спорідненістю, щонайменше, близько 1×10-9М, 1×10-10М, 1×10-11М, або 1×10-12М до GAS6. У різних варіантах втілення, описаних тут, розчинний варіант поліпептиду AXL показує спорідненість до GAS6, що, щонайменше, приблизно в 2 рази сильніше, ніж спорідненість поліпептиду AXL дикого типу. В деяких варіантах втілення розчинний варіант полипептв 25 разів, або у 30 разів сильніше, ніж спорідненість поліпептиду AXL дикого типу.

В іншому варіанті втілення даний винахід забезпечує виділені антитіла або їх фрагменти, які специфічно зв'язуються з GAS6 білком (SEQ ID NO:2). В деяких варіантах втілення виділене антитіло або його фрагмент являє собою моноклональне антитіло, гуманізоване антитіло, химерное антитіло, одноцепочечное антитіло (ScFv) або їх комбінації. В деяких інших варіантах втілення виділене антитіло або його фрагмент пов'язує епітоп, який складається з одного або декількох амінокислотних ділянок GAS6, які обрані з групи, що складається з R299-T317, V364-P372, R389-N396, D398-A406, Е413-Н429, і W450-M468. Ще в кількох інших варіантах втілення виділене антитіло або його фрагмент пов'язує епітоп, який містить амінокислотний ділянку, обраний із групи, що складається з RMFSGTPVIRLRFKRLQPT (SEQ ID NO:3), VGRVTSSGP (SEQ ID NO:4), RNLVIKVN (SEQ ID NO:5), DAVMKIAVA (SEQ ID NO:6), ERGLYHLNLTVGGIPFH (SEQ ID NO:7) і WLNGEDTTIQETVKVNTRM (SEQ ID NO:8).

Ще В одному варіанті втілення даний винахід відноситься до способів лікування, зниження або запобігання метастазування, або інвазії пухлини в організмі пацієнта, що відноситься до ссавців. В одному варіанті втілення спосіб�анти-GAS6 антитіла, або його фрагмента.

Ще В одному варіанті втілення даний винахід відноситься до способів лікування, зниження або запобігання метастазування, або інвазії пухлини в організмі пацієнта, що відноситься до ссавців. В одному варіанті втілення спосіб включає введення одного або декількох інгібіторів, вибраних з групи, що складається з (а) інгібітора активності AXL, (b) інгібітора активності GAS6; і (с) інгібітора взаємодії AXL-GAS6. У різних варіантах втілення, описаних тут, інгібітор являє собою поліпептид, полинуклеотид, невелику молекулу, антитіло, фрагмент антитіла, або лікарський кон'югат антитіла.

Ще в одному варіанті втілення даний винахід пропонує способи визначення здатності до інвазії пухлини або метастазування в суб'єкті. В одному з варіантів втілення спосіб включає в себе визначення рівня активності AXL і/або активності GAS6 в біологічному зразку від суб'єкта з пухлиною; порівняння рівня активності AXL та/або GAS6 в біологічному зразку з заздалегідь встановленим рівнем, у якому збільшення порівняно з заздалегідь встановленим рівнем, що свідчить про схильності до інвазії пухлини або метастазування.

�ака молочної залози і раку яєчників людини. А. Репрезентативні зображення імуногістохімічного фарбування AXL в нормальній тканині молочної залози (нормальний), первинних інфільтратах протоковою карциноми (стадія 1, 2, і 3) і метастазах лімфатичних вузлів (лімфатичні вузли). Слід зазначити, що високий рівень мембранного фарбування AXL спостерігається на 2 стадії (стрілки), 3-й стадії, а також на метастази в лімфовузли. Відсутність фарбування AXL спостерігався в нормальній або пухлинної стромі (*). Ст. Репрезентативні зображення імуногістохімічного фарбування AXL у нормальному епітелії яєчників (стрілка), стадія ІІ стадія ІІІ, і метастазах сальника, отриманих від пацієнтів з серозної аденокарциномой. Зверніть увагу, що нормальна і пухлинна строми були негативними по фарбуванню AXL (*).

Фігура 2. Генетичної інактивації AXL достатньо, щоб заблокувати метастази молочної залози і яєчників. А. Імуногістохімічне фарбування Н & Е і AXL в легенях мишей; через хвостову вену мишам вводили клітини лінії MDA-231 shscramble (мала шпилечная РНК випадкової послідовності shSCRM) і shAXL (мала шпилечная РНК до послідовності AXL-shAXL). На фотографії представлені 5 мишей з групи. Графіки показують результати ПЛР в реальному часи. Фотографії мишей, зроблені через 28 днів після ін'єкції SKOV3ip.1 клітин shscramble (shSCRM) і shAXL (shAXL). Зверніть увагу, що введення shSCRM мишам призвело до розвитку численних метастазів в черевній порожнині (відмічені кружком). Для shAXL групи показані миші з найбільшою пухлинної навантаженням. Графіки праворуч показують середня кількість перитонеальних метастазів миші >5 мм за розміром і середній вага великих пухлин. На фотографії представлені п'ять мишей з групи. С. Фотографії мишей, зроблені через 34 дні після ін'єкції OVCAR-8 клітин shSCRM і shAXL. Зверніть увагу, що введення shSCRM мишам призводило до розвитку численних метастазів в черевній порожнині (відмічені кружком). Графіки праворуч показують середнє загальне число перитонеальних метастазів на мишу і середню загальну масу пухлини. На фотографії представлені вісім мишей з групи.

Постать 3. Генетична інактивація AXL не впливає на проліферацію клітин пухлини молочної залози або яєчників in vitro або зростання in vivo. А. Криві клітинного росту для MDA-231, SKOV3ip.1 і OVCAR-8 клітин стабільно експресують послідовності shPHK контролю scramble (shSCRM) або AXL (shAXL). Вимірювання проводилися тричі, і похибка вимірювань представлена S. E. M. Ст. Середні обсяги пухлини ортотоп�огрешность вимірювань представлена S. E. M.

Фігура 4. AXL регулює інвазію клітин пухлини яєчників і молочної залози in vitro. А. Аналіз інвазії в колаген під контролем (shSCRM) і з дефіцитом AXL (shAXL) клітин MDA-231, SKOV3ip.1 і OVCAR-8. Фотографії були зроблені через 7 днів після впровадження клітин у колаген і на них представлено по три зразка з групи. Зверніть увагу на інвазивний фенотип, спостережуваний в AXL клітинах дикого типу (розгалуження) порівняно з AXL дефіцитними клітинами (округлий). Графіки показують кількісний аналіз інвазії в колаген. В. Аналіз способом ПЛР в реальному часі експресії ММР-2 в shAXL і shSCRM SKOV3ip.1 клітин. Значення експресії унормовані на 18S; п=3. Похибка визначення представлена S. E. M.. Зірочки вказують на значне збільшення або зменшення експресії порівняно з shSCRM, як це визначено за t-критерієм Стьюдента (**, p < 0,001). С. ММР-2 значення аналізу shSCRM або shAXL SKOV3ip.1 клітин (п=6). D. Желатинова зимография аналізу активності про - та активного - ММР-2, у кондиціонованому середовищі, зібраної з сироватки виснажених SKOV3ip.1 клітин. Е. Вестерн-блот аналіз фосфорна-AKT на Ser473 (P-AKT), загальна AKT (AKT), і експресії AXL в SKOV3ip.1 клітинах, що експресують ShРНК цільові послідовності для контролю scramble (shSCRM) або AXL (shAXL) і виснажених SKOV3ip.1 клітин (stработанних з GAS6 або GAS6 з інгібітором PI3K Ly294002 (Ly+GAS6).

Постать 5. Эктодоменная терапія розчинними AXL інгібує AXL сигналізацію і інвазію in vitro. А. Схематичне зображення механізму терапії розчинними AXL. Розчинні AXL (sAXL) функціонують у якості рецепторів-пасток для інгібування ендогенної передачі сигналу AXL. Ст. Вестерн-блот аналіз фосфорна-AKT на Ser473 (P-AKT), загальною AKT (AKT) і експресії AXL в клітинах MDA231, SKOV3ip.1 і OVCAR-8, експресують послідовності ShPHK контролю scramble (shSCRM) або AXL (shAXL), і виснажених клітин SKOV3ip.1 (strve), оброблених GAS6 або інгібітором PI3K Ly294002 (Ly) з GAS6. С. Вестерн-блот аналіз експресії фосфорна-AKT Ser473a клітинах, оброблених в одній з кондиціонованих середовищ, що містять розчинну AXL рецептор (sAXL) або контрольну середу (-). Всі клітини культивували у бессивороточной середовищі протягом 48 годин і обробляли GAS6 (+) або контрольної середовищем (-). D. Аналіз інвазії в колаген MDA-231 клітин, оброблених кондиціонованому середовищем, що містить контрольний вектор або sAXL.

Фігура 6. Лікування за допомогою розчинних AXL рецепторів інгібує метастатичну пухлинну навантаження у мишей з встановленими метастазами. А. Схематичне зображення дослідження лікування розчинним AXL рецептором. Голим мишам в. п. (інтраперитонеально) ввели 1×106SKOV3ip.1 �і показана миша з перитонеальним метастазом на 5-й день після ін'єкції, метастатичні ураження відмічено кружком). На 7-й день мишам вводили аденовірус, экспрессирующий IgG2a-Fc контроль (Ad-Fc) або розчинна AXL рецептор (Ad-sAXL). Сироваткові рівні експресії sAXL оцінювали за даними Вестерн-блот кожні 3-4 дні після аденовірусної ін'єкції. У наступні 28 днів, після імплантації пухлинних клітин, оцінювали пухлинну навантаження у всіх мишей. В. Представлені фотографії мишей, що отримували шляхом експресії аденовірусу Ad-sAXL або Ad-Fc через 28 днів після ін'єкції пухлинних клітин. Метастатичні ураження відмічено кружком. Графіки показують середню загальну кількість і вага пухлини для 7 мишей у групі. Похибка вимірювань представлена S. E. M.. Зазначимо, що статистична різниця в кількості пухлини і вазі (р=0,01, t-критерій Стьюдента) спостерігалася між мишами, обробленими Ad-Fc або shPHK Ad-sAXL (*). С. Аналіз ПЛР в реальному часі експресії ММР-2 в пухлини мишей з Ad-Fc або Ad-AXL.

Фігура 7. Терапія розчинними эктодоменами AXL не викликає токсичність у нормальних тканинах. А. Повне СВС і біохімічний аналіз сироватки мишей, обробленими контролем (Fc) або розчинними AXL (sAXL). В. Н & Е фарбування тканин печінки і нирок, відібраних у мишей оброблених Fc або sAXL.

Фігура 8. Схе� AXL. Терапія розчинним рецептором AXL (sAXL) діє як рецептор-пастка, який зв'язується з лігандом AXL GAS6. sAXL інгібує шлях ендогенної GAS6-AXL сигналізації, який стимулює клітинну інвазії і метастазування.

Фігура 9. Створення дефіцитних за AXL ліній ракових клітин молочної залози і яєчників. А. Вестерн-блот аналіз експресії AXL на панелі людських ліній ракових клітин молочної залози і яєчників. Білок теплового шоку 70 (Hsp70) був використаний в якості контролю завантаження білка. Ст. Вестерн-блот аналіз експресії AXL в лініях ракових клітин метастатичного раку молочної залози (MDA-231), яєчників (SKOVSip.1 і OVCAR-8), стабільно трансфекованих мшРНК послідовністю контролю (scramble) (shSCRM) або AXL (shAXL). Зверніть увагу, що shAXL клітинні лінії мають значне зменшення експресії AXL.

Фігура 10. AXL не впливає на клітинну адгезію або виживання клітин пухлини молочної залози і яєчників. А-Ст. Відсоток міграції клітин MDA-231 (А) і SKOVSip.1 (В) міграції клітин до сироватці, яка виступає як хемоаттрактант, при аналізі в камері Бойдена. C-D. Аналізи MDA-231 (A) SKOV3ip.1 (В) клітинної адгезії до білків позаклітинного матриксу. Скорочення: бичачий сироватковий альбумін (BSA), фібронектин (FN), колаген типу I (Col I),у середнього. E-F. Аналіз виживання AXL дикого типу і AXL дефіцитних MDA-231 (Е) і SKOV3ip.1 (F) пухлинних клітин після видалення сироватки, як це визначено ХТТ аналізом.

Фігура 11. Лікування за допомогою розчинних AXL рецепторів інгібує метастатичну пухлинну навантаження у мишей з встановленими OVCAR-8 метастазами. А. Схематичне зображення дослідження лікування розчинним AXL рецептором. Голим мишам були інтраперитонеально введені 5×106OVCAR-8 клітин. Через чотирнадцять днів після імплантації перевіряли наявність макроскопічних поразок у мишей (на фотографії показана миша з перитонеальним метастазом на 14-й день після ін'єкції, метастатичні ураження відмічено кружком). На 14-й день мишам вводили аденовірус, экспрессирующий IgG2a-Fc контроль (Ad-Fc) або розчинна AXL рецептор (Ad-sAXL). Сироваткові рівні експресії sAXL оцінювали за даними Вестерн-блот аналізу. У наступні 3-4 дні після імплантації пухлинних клітин, пухлинну навантаження оцінювали у всіх мишей. В. Представлені фотографії мишей, які отримували аденовіруси, що експресують Ad-sAXL або Ad-Fc через 28 днів після ін'єкції пухлинних клітин. Метастатичні ураження відмічено кружком. С. Графіки показують середню загальну кількість і вага пухлини для 8 ми� пухлини (p < 0,01, t-критерій Стьюдента) спостерігалася між мишами, яких лікували Ad-Fc і Ad-sAXL (*).

Фігура 12. Аналіз зв'язування AXL бібліотеки виявив 5 продуктів для GAS6. На точковому графіку проточної цитометрії дріжджових клітин, що експресують AXL дикого типу (А) або пул AXL, виділяється 5 продуктів отриманих шляхом спрямованої еволюції (В). Представлені дані аналізу зв'язування з подальшою дисоціацією, описаного в прикладі 2. Рівень зв'язування з 2 нМ GAS6 показаний у лівій колонці, рівень зв'язування з GAS6 після 4 годин показаний в середній колонці, і рівні зв'язування з GAS6 після 6 годин наведені в правій колонці. Для клітин, які є позитивними за експресії конкретного білка на поверхні клітини (правий верхній квадрант кожної точки ділянки проточної цитометрії), рівні зв'язування з GAS6 (y-вісь) кількісно представлені на графіку нижче. Виділені п'ять продуктів показують значно краще зв'язування з GAS6 порівняно з диким типом AXL.

Фігура 13. Зв'язування покращених варіантів AXL з GAS6. Ліва панель показує рівновагу зв'язування GAS6 з мутантами AXL S6-1 (червоний квадрат) і S6-2 (блакитні ромби) порівняно з диким типом AXL (зелені гуртки). Мутанти S6-1 і S6-2 показують значно більш високі рівні порівнянні з диким типом AXL. У правій панелі показана кінетика дисоціації Gas6-AXL взаємодії для AXL дикого типу або сконструйованого AXL. При взаємодія Gas6 з диким типом AXL утворюється Gas6-AXL «дикий тип», який розпадається швидко, як функція від часу, в той час як при взаємодії сконструйованих S6-1 ("S6-1") або S6-2 ("S6-2") з Gas6 показано значне збільшення схоронності зв'язування.

Фігура 14. Внутрибрюшинная доставка очищеного AXL S6-1-Fc показує посилення терапевтичного ефекту дикого типу AXL-Fc і AXL E59R/T77R-Fc. Представлено два зображення розтину мишей з трьох груп лікування, AXL E59R/T77R-Fc, AXL-Fc дикого типу, і AXL S6-1-Fc. Чорні кружки на знімках, вказують на видиме метастатичне ураження, але не обов'язково показують всі метастази. AXL-Fc дикого типу показує помірне пригнічення метастазування, але перевищує негативний контроль, AXL E59R/T77R, a AXL S6-1 показує майже повне пригнічення метастазування.

Фігура 15. Інгібування метастазування в ксенографной моделі SKOV3ip.1. На перших двох графіках один і той же набір даних представлений двома різними способами, щоб показати, як середня кількість метастазів враховується у кожній групі лікування. Крім того, два нижніх графіка показують той жкого типу перешкоджає поширенню метастазів у порівнянні з негативним E59R/T77R-Fc контролем, про що свідчить зниження як кількості пошкоджень (верхня панель), так і загальна вага (нижня панель). AXL S6-1-Fc показує значне зниження пухлинної маси порівняно з диким типом AXL-Fc і AXL E59R/T77R-Fc, як можна оцінити за кількістю поразок (верхня панель), а також вазі (нижня панель). Ці дані показують, що збільшене спорідненість AXL S6-1 забезпечує підвищену терапевтичну ефективність для дикого типу, і що AXL S6-1-Fc є ефективним способом лікування для боротьби з метастазуванням.

Визначення

В описі, представленому нижче, широко використовується цілий ряд термінів, що зазвичай застосовуються в галузі культури клітин. З метою забезпечення чіткого і послідовного розуміння опису та формули винаходу, а також обсягу, визначеного цими термінами, передбачені наступні визначення.

"Інгібітори", "активатори" і "модулятори" AXL на метастатичних клітинах або його ліганда GAS6 використовуються для позначення інгібуючих, що активують або модулюючих молекул відповідно, та визначено з використанням in vitro та in vivo аналізів зв'язування рецепторів або лігандів, і передачі сигналів, наприклад, лігандів, рецепторів, агоністів, антагоністів і їх гомологоия полімеру, складається з амінокислотних залишків. Термін поширюються і на амінокислотні полімери, в яких один або більше амінокислотних залишків є штучним хімічним миметиком, відповідним природного амінокислоти, а також на природні амінокислотні полімери, і не зустрічаються в природі амінокислотні полімери.

Термін "амінокислота" означає природні і синтетичні амінокислоти, а також аналоги амінокислот і миметики амінокислот, які функціонують подібно до природних амінокислот. Природні амінокислоти кодуються генетичним кодом, також як амінокислоти, які потім модифікуються, наприклад, гідроксипролін, гамма-карбоксиглутамат і O-фосфосерин. Аналоги амінокислот відносяться до сполук, які мають ту ж основну хімічну структуру природних амінокислот, тобто альфауглерод, який пов'язаний з воднем, карбоксильної групою, аміногрупою та R групою, наприклад, гомосерин, норлейцин, метионинсульфоксид, S-метилметионин. Такі аналоги, мають змінені R групи (наприклад, норлейцин) або модифіковані бічні пептидні зв'язки, але у них зберігається базова хімічна структура природних амінокислот. Миметики амінокислот відносяться до химиѰналогичние природних амінокислот. У цьому винаході використовуються окремі букви, для позначення амінокислот, які є загальноприйнятими символами амінокислот, які широко використовуються в цій області, наприклад, А означає аланін, означає цистеїн і ін Коли амінокислота представлена однією буквою до і після відповідної позиції, це означає заміну первісної амінокислоти (до) в даній позиції на змінену амінокислоту (після). Наприклад, А19Т означає, що амінокислоти аланін у положенні 19 змінюється на треонін.

Термін "суб'єкт", "індивід" і "пацієнт" використовуються тут взаємозамінними для позначення ссавців, яких аналізують в процесі лікування і/або які проходять лікування. В одному варіанті втілення ссавець є людиною. Терміни "суб'єкт", "індивід" і "хвора" таким чином, охоплюють осіб, які мають рак, у тому числі, без обмежень, аденокарциноми яєчників або простати, рак молочної залози, гліобластоми і т. д., у тому числі тих, хто піддався або є кандидатами на видалення злоякісної тканини (операцію). Суб'єкти можуть бути людиною, але також включають і інших ссавців, особливо ссавців, корисних в якості лабораторних моделей для захворювань людям клітинних утворень, незалежно від злоякісного або доброякісного характеру проліферації, і всім передракових та ракових клітин і тканин.

Терміни "рак", "новоутворення" і "пухлина" використовуються тут взаємозамінними для позначення клітин, які характеризуються автономним, нерегульованим зростанням так, що вони володіють аномальним фенотипом зростання, і характеризуються значною втратою контролю над клітинною проліферацією. Загалом, клітини, що представляють інтерес для виявлення, аналізу, класифікації чи лікування в цій заявці включають передракові (наприклад, доброякісні), злоякісні, преметастатические, метастатичні і неметастатические клітини. Приклади раку включають, але не обмежуються ними, рак яєчників, гліобластомою, рак молочної залози, рак товстої кишки, рак легенів, рак передміхурової залози, гепатоцелюлярний рак, рак шлунка, рак підшлункової залози, рак шийки матки, рак яєчників, рак печінки, рак сечового міхура, рак сечовивідних шляхів, рак щитовидної залози, рак нирки, карциномою, меланому, рак голови та шиї, а також рак мозку.

"Патологія" раку включає в себе всі явища, які ставлять під загрозу благополуччя пацієнта. Це включае�тво в нормальне функціонування сусідніх клітин, секреція цитокінів або інших секреторних продуктів в аномальних кількостях, придушення або загострення запальної або імунологічної реакції, неоплазію, передпухлинний стан, злоякісні пухлини, інвазії в навколишні або віддалені тканини або органи, такі як лімфатичні вузли, і т. д.

Терміни "раковий рецидив" і "пухлинний рецидив", як вони використовуються тут, і їх граматичні варіанти позначають подальше зростання пухлинних або ракових клітин після встановлення діагнозу рак. Зокрема, рецидив може статися, коли подальше зростання ракової клітини відбувається в ракової тканини. "Поширення пухлини" також відбувається, коли клітини пухлини поширюються в місцевих або віддалених тканинах і органах, тому поширення пухлини включає в себе метастазування пухлини. "Інвазія пухлини" виникає, коли зростання пухлини поширився на місцевому рівні, порушуючи функції беруть участь тканин за рахунок стиснення, деструкції або запобігання нормальної функції органу.

Термін "метастазів", як він використаний тут, відноситься до зростання ракової пухлини в органі або частини тіла, які безпосередньо не пов'язані з органом первинної ракової пухлини. МЀакових клітин в органі або частини тіла, які безпосередньо не пов'язані з органом первинної ракової пухлини. Метастазування може бути визначено як кілька кроків процесу, таких як вихід ракових клітин з місця первинної пухлини, міграція та/або інвазія ракових клітин в інші частини тіла. Таким чином, даний винахід передбачає спосіб визначення ризику подальшого зростання однієї або кількох ракових пухлин в органі або частини тіла, які безпосередньо не пов'язані з органом первинної ракової пухлини, та/або будь-які кроки в процесі підготовки для цього зростання.

Залежно від характеру раку виходить відповідний зразок пацієнта. Використовується тут вираз "раковий зразок тканини" відноситься до будь-яких клітин, отриманих з ракової пухлини. У випадку твердих пухлин, які не метастазують, зразок тканини отримують з видаленої пухлини хірургічним шляхом, і готують до тестування за допомогою звичайних методик.

Для визначення використовується кров та інші рідкі зразки біологічного походження, тверді зразки тканин, такі як біопсія або тканинні культури, або клітини, отримані з неї і їх потомство. При визначенні також використовуються зразки, які були зрад� певних клітинних популяцій, таких як ракові клітини. Зразок також може бути збагачений окремими видами молекул, наприклад, нуклеїновими кислотами, поліпептидами і т. д. Термін «біологічний зразок» включає в себе клінічний зразок, а також тканину, отриману при хірургічної резекції, тканину, отриману при біопсії, клітини в культурі, супернатанти клітин, клітинні лізати, зразки тканин, органів, кісткового мозку, крові, плазми, сироватки, тощо. «Біологічний зразок» також включає в себе зразок, отриманий від ракових клітин пацієнта, наприклад, зразок, включає полінуклеотиди і/або поліпептидів, які виходять із ракових клітин пацієнта (наприклад, лізат клітин або інших клітинних екстрактів, що включають полінуклеотиди і/або поліпептидів); а також зразок, що включає ракові клітини пацієнта. Біологічний зразок, що містить ракові клітини від пацієнта, також може включати неракові клітини.

Термін "діагностика" використовується тут для позначення визначення молекулярного або патологічного стану або хвороби, таких як ідентифікація молекулярних підтипів раку молочної залози, раку передміхурової залози або інших видів раку.

Термін "прогноз" використовується тут для обоз�тазирования і лікарської стійкості пухлинних захворювань, таких як рак яєчників. Термін "передбачення" використовується тут для позначення акта прогнози або оцінки, заснованого на спостереженнях, досвід і наукових міркуваннях. В одному прикладі лікар може передбачити ймовірність того, що пацієнт виживе після хірургічного видалення первинної пухлини і/або хіміотерапії протягом певного періоду часу без рецидиву раку.

Використовувані тут терміни "лікування", "лікувати" і тому подібні, ставляться до введення агента або проведення процедури (наприклад, опромінення, хірургічне втручання тощо) з метою отримання ефекту. Ефект може бути профілактичним з точки зору повного або часткового запобігання хвороби або її симптому, і/або може бути терапевтичним з точки зору здійснення часткового або повного лікування від хвороби та/або симптомів захворювання. "Лікування", що використовується тут, включає в себе будь-яке лікування будь метастатичної пухлини у ссавців, зокрема у людини, і включає: (а) запобігання хвороби або симптому захворювання, що протікає в суб'єкті, який може бути схильний до хвороби, але до цих пір у нього її не діагностували (наприклад, при наявності у суб'єкта захворювань, які можуть б; � (с) полегшення хвороби, тобто регрес захворювання. При лікуванні пухлини (наприклад, раку), терапевтичний агент може безпосередньо зменшити метастазування пухлинних клітин.

Лікування може ставитися до будь-яких ознаках успіху в лікуванні або покращення, або профілактики раку, в тому числі об'єктивним або суб'єктивним параметрам, таким як припинення, ремісія; зменшення симптомів або прийняття хворобою стану більш терпимого для пацієнта; уповільнення швидкості дегенерації або погіршення; або робить кінцеву точку виродження менш виснажливою. Лікування або полегшення симптомів може бути засноване на об'єктивних або суб'єктивних параметрах, у тому числі на результатах досліджень лікаря. Таким чином, термін «лікування» включає в себе введення сполуки або агента цього винаходу, щоб запобігти або припинити, щоб полегшити або затримати, або інгібувати розвиток симптомів або стану, пов'язаного з неоплазією, наприклад, пухлиною або раком. Термін "терапевтичний ефект" відноситься до скорочення, ліквідації або запобігання хвороби, симптомів хвороби або побічних ефектів хвороби у суб'єкта.

Терміни "в поєднанні з", "комбінована терапія�у першого терапевтичного агента і з'єднань, які використовуються тут. При прийомі внутрішньо у комбінації кожен компонент може бути введений одночасно або послідовно в будь-якому порядку в різні моменти часу. Таким чином, кожен компонент може бути введений окремо, але досить близько в часі таким чином, щоб забезпечити необхідний терапевтичний ефект.

У відповідності з цим винаходом перший терапевтичний агент може бути будь-яким підходящим терапевтичним агентом, наприклад, цитотоксичними агентами. Один типовий клас цитотоксичних агентів являють хіміотерапевтичні агенти, наприклад, які можуть бути об'єднані з лікуванням для інгібування AXL або GAS6 сигналізації. Типові хіміотерапевтичні агенти включають, але не обмежуються цим, альдеслейкин, альтретамин, аміфостин, аспарагінази, блеомицин, капецитабін, карбоплатин, кармустин, кладрибин, цизаприд, цисплатин, циклофосфамід, цитарабін, дакарбазин (DTIC), дактіноміцін, доцетаксел, доксорубіцин, дронабинол, дуокармицин, эпоэтин альфа, етопозид, филграстим, флударабин, фторурацил, гемцитабін, гранісетрон, гидроксимочевину, идарубицин, ифосфамид, інтерферон альфа, іринотекан, лансопразол, левамізол, лейковорин, мегестрТаксол™), пілокарпін, прохлороперазин, рітуксімаб, сапроин, тамоксифен, таксол, топотекана гідрохлорид, трастузумаб, вінбластин, вінкристин і винорельбина тартрат. Для лікування раку яєчників кращим хіміотерапевтичних агентом, з яким можуть бути об'єднані інгібітори сигналізації AXL або GAS6, є паклітаксел (Таксол™).

Інші комбіновані терапії включають опромінення, операції та гормональну депривацию (Kwon et al., Proc. Natl. Acad. Sci U. S. A., 96:15074-9, 1999). Інгібітори ангіогенезу можуть комбінуватися зі способами винаходу.

"Одночасне введення" відомого протиракового терапевтичного препарату з фармацевтичної композицією цього винаходу означає введення препарату та інгібітора AXL в такий час, коли відоме ліки і композиція цього винаходу будуть мати лікувальний ефект. Таке одночасне введення може включати супутнє (тобто в той же час), попереднє або наступне введення препарату по відношенню до застосування сполуки цього винаходу. Фахівець в даній області не матиме труднощів з визначенням відповідних термінів, послідовності і дозування введення для конкретних препаратів і композицій нас відсутності рецидиву пухлини та/або розповсюдження, і долю пацієнта після постановки діагнозу, щодо впливу раку на тривалість життя пацієнта. Фраза "загальна виживаність" відноситься до долі пацієнтів після постановки діагнозу, незважаючи на можливість того, що причина смерті пацієнта безпосередньо не пов'язана з наслідками раку. Фрази "ймовірність виживаності без ознак захворювання", "ризик рецидиву" та їх варіанти звернені до ймовірності рецидиву пухлини або її поширення у пацієнта після постановки діагнозу «рак», в якому ймовірність визначається у відповідності зі способом винаходу.

Термін "корелює" або "корелює з" і подібні терміни, як вони використані тут, відноситься до статистичного зв'язку між прикладами двох подій, де події включають цифри, набори даних, тощо. Наприклад, коли події пов'язані з числами, позитивна кореляція (також звана тут "прямий зв'язок") означає, що коли один росте, другий також збільшується. Негативна кореляція (також звана тут "зворотна кореляція") означає, що коли один росте, другий зменшується.

"Одиниця дозування" відноситься до фізично дискретним одиницям, відповідним стандартним доз для лікування конкретнполучения бажаного терапевтичного ефекту(ів) в поєднанні з необхідним фармацевтичним носієм. Конкретна форма одиниці дозування може бути продиктована (а) унікальними характеристиками активного з'єднання(й), та, зокрема, лікувального ефекту(ів), який повинен бути досягнутий, і (b) обмеженнями, що виникають при змішуванні такого активного з'єднання(ї).

"Фармацевтично прийнятний наповнювач" означає наповнювач, який буде корисний при підготовці фармацевтичної композиції, які, як правило, безпечні, нетоксичні, і, бажано, включає в себе допоміжні речовини, які є прийнятними для використання у ветеринарії, а також для використання в фармацевтичних цілях для людини. Такі наповнювачі можуть бути твердими, рідкими, напівтвердою або, у разі аерозольного складу, газоподібними.

"Фармацевтично прийнятні солі та ефіри" означає солі та ефіри, які фармацевтично прийнятні і мають бажані фармакологічні властивості. Такі солі включають солі, які можуть бути утворені кислими протонами, які присутні в з'єднанні і здатні реагувати з неорганічними або органічними основами. Відповідні неорганічні солі включають солі, що формуються з лужними металами, наприклад, натрієм і калієм, магнієм, �такими як основні аміни, наприклад, етаноламін, діетаноламін, триетаноламін, трометамін, N-метилглюкамин тощо. Такі солі включають також солі приєднання кислоти, утворені з неорганічними кислотами (наприклад, соляної та бромистоводородной кислотами) та органічними кислотами (наприклад, оцтової кислотою лимонною кислотою, малеїновою кислотою, і алкан - і аренсульфокислотами, такими як метансульфокислота і бензолсульфокислота). Фармацевтично прийнятні складні ефіри включають ефіри, утворені з карбокси, сульфонилокси і фосфонокси груп, присутніх у з'єднаннях, наприклад, C1-6алкільних ефірів. При наявності двох кислотних груп фармацевтично прийнятна сіль або ефір може бути монокислота-моносоль або ефір або дисоль або ефір; а також там, де є більше двох кислотних груп, деякі або всі ці групи беруть участь у солеобразовании або етерифікації. З'єднання, зазначені у цьому винаході, можуть бути присутніми в "несолевой" або неэтерифицированной формі або у формі солі, та/або этерифицированной формі і при згадці таких сполук розуміється як вихідні (несолевие і неэтерифицированние) з'єднання, так і їх фармацевтично прийнятні солі і ефі� стереоизомерних формах і згадки таких з'єднань повинні охоплювати всі індивідуальні стереоізомери і всі суміші (рацемические або іншим чином організовані) таких стереоизомеров.

Терміни "фармацевтично прийнятний", "фізіологічно прийнятний" і їх граматичні варіанти, відносяться до композицій, носіям, розріджувачам і реагентів, які використовуються як синоніми, і заявляють, що матеріали застосовні до використання, або для людини, без прояву небажаних фізіологічних ефектів до такої міри, щоб заборонити застосування композиції.

"Терапевтично ефективна кількість" означає кількість, яка, при введенні об'єкта з метою лікування захворювань, достатньо, щоб здійснити лікування цих хвороб.

Детальний опис

У відповідності з цим винаходом, пропонуються розчинні варіанти AXL, наприклад, розчинний варіант поліпептиду AXL, у якого активність зв'язування з GAS6 по суті дорівнює або краще, ніж активність зв'язування поліпептиду AXL дикого типу. В деяких варіантах втілення винаходу, розчинний варіант поліпептиду AXL використовується в якості терапевтичних агентів.

Білок AXL, з посиланням на нативну послідовність SEQ ID NO:1, складається з імуноглобулін(Ig)-такого домену, утвореного залишками 27-128, другого Ig-такого домену, утвореного залишками 139-222, доменів фібронектину типу 3, обра�тирозинкінази. Залишки тирозину в 779, 821 і 866 положеннях стають аутофосфорилированними при дімерізаціі рецептора і служать ділянками приєднання внутрішньоклітинних сигнальних молекул. Нативний сайт розщеплення, для вивільнення розчинної форми поліпептиду, знаходиться на залишках 437-451.

Для цілей винаходу розчинна форма AXL - це частина поліпептиду, яка є достатньою для зв'язування GAS6 з помітним спорідненістю, наприклад, з високою спорідненістю, яка зазвичай знаходиться між сигнальної послідовністю і трансмембранним доменом, тобто зазвичай становить від, приблизно, залишку 19 до залишку 437 в SEQ ID NO:1, але які можуть включати або складатися в основному з урізаною версією приблизно від залишку 19, 25, 30, 35, 40, 45, 50 до залишку 132, 450, 440, 430, 420, 410, 400, 375, 350 і 321, наприклад, залишки 19-132. В деяких варіантах втілення розчинній формі AXL не вистачає трансмембранного домену і, можливо, внутрішньоклітинного домену.

Розчинний варіант Поліпептидів AXL (варіанти sAXL) у цьому винаході включає одну або декілька модифікацій амінокислот в межах розчинній формі дикого типу AXL, наприклад, одну або декілька модифікацій амінокислот, які підвищують його спорідненість до GAS6. У відповідності з цим изЋе відомі чи пізніше будуть виявлені в цій області. В деяких варіантах втілення модифікації амінокислот включають природні мутації, наприклад, заміна, видалення, додавання, вставка і т. д. В деяких інших варіантах втілення модифікації амінокислот включають в себе заміну існуючої амінокислоти інший амінокислотою, наприклад, консервативним її еквівалентом. В деяких інших варіантах втілення, модифікація амінокислоти включають заміну однієї або декількох існуючих амінокислот неприродними амінокислотами, або вставку однієї або декількох неприродних амінокислот. У ще кількох інших варіантах втілення, модифікації амінокислоти включають щонайменше, 1, 2, 3, 4, 5 або 6, або 10 амінокислотних мутацій або змін.

У деяких типових варіантах втілення одна або кілька модифікацій амінокислоти може бути використана для зміни властивостей розчинних форм AXL, наприклад, впливати на стабільність, зв'язуючу активність і/або специфічність, і т. д. Способи in vitro мутагенезу клонованих генів відомі. Приклади протоколів для сканування мутацій можуть бути знайдені в Gustin et al., Biotechniques 14:22 (1993); Barany, Gene 37:111-23 (1985); Colicelli et al., Mol Gen Genet 199:537-9 (1985); і Prentki et al., Gene 29:303-13 (1984). Способи сайтспецифического мутагенезу міг�2); Jones and Winistorfer, Biotechniques 12:528-30(1992); Barton et al., Nucleic Acids Res 18:7349-55 (1990); Marotti and Tomich, Gene Anal Tech 6:67-70 (1989); і Zhu Anal Biochem 177:120-4 (1989).

В деяких варіантах втілення варіанти sAXL цього винаходу включають одну або декілька модифікацій амінокислот в одному або декількох ділянках від 18 залишку до 130, від 10 до залишку 135, від 15 залишку до 45, від 60 до залишку 65, від 70 до залишку 80, 85 залишку до 90, 91 залишку до 99, 104 від залишку до 110, 111 залишку до 120, від 125 залишку до 130, від 19 залишку до 437, від 130 до залишку 437, від 19 залишку до 132, від 21 до залишку 132, від 21 залишку до 121, від 26 залишку до 132 або від 26 залишку до 121 у послідовності AXL дикого типу (SEQ ID NO:1). В деяких інших варіантах втілення варіанти sAXL цього винаходу включають одну або декілька модифікацій амінокислот в одному або декількох ділянках від 20 залишку до 130, від 37 до залишку 124 або від 141 до залишку 212 в AXL дикого типу (SEQ ID NO:1). Ще в деяких інших варіантах втілення варіанти sAXL цього винаходу включають одну або декілька модифікацій амінокислот, відповідають положенням 19, 23, 26, 27, 32, 33, 38, 44, 61, 65, 72, 74, 78, 79, 86, 87, 88, 90, 92, 97, 98, 105, 109, 112, 113, 116, 118, 127 чи 129 в послідовності AXL дикого типу (SEQ ID NO:1).

В деяких інших варіантах втілення варіанти sAXL настояще�23М, 3) E26G, 4) E27G або E27K, 5) G32S, 6) N33S, 7) T38I, 8) Т44А, 9) H61Y, 10) D65N, 11) A72V, 12) S74N, 13) Q78E, 14) V79M, 15) Q86R, 16) D87G, 17) D88N, 18) I90M або 190 V, 19) V92A, V92G або V92D, 20) I97R, 21) Т98А або Т98Р, 22) Т105М, 23) Q109R, 24) V112A, 25) F113L, 26) H116R, 27) T118A, 28) G127R або G127E і 29) E129K, і їх комбінації.

В деяких інших варіантах втілення варіанти sAXL цього винаходу включають одну або більше модифікацій амінокислот у позиції 32, 87, 92 або 127 дикого типу AXL (SEQ ID NO:1) чи їх поєднання, наприклад, G32S; D87G; V92A та/або G127R. Ще в деяких інших варіантах втілення варіанти sAXL цього винаходу включають одну або декілька модифікацій амінокислот у положенні 26, 79, 92, 127 дикого типу AXL (SEQ ID NO:1) чи їх поєднання, наприклад, E26G, V79M; V92A та/або G127E.

У відповідності з цим винаходом варіанти sAXL цього винаходу можуть бути надалі змінені, наприклад, приєднанням до широкого кола інших олигопептидов або білків для різних цілей. Наприклад, різні посттрансляционние або постэкспрессионние модифікації можуть бути здійснені щодо варіантів sAXL цього винаходу. Наприклад, при використанні відповідних кодують послідовностей, можна забезпечити фарнезирование (процес перенесення груп ферментом фарнезилтрансферазой) або пренилированиеупп до C-кінцевих залишків цистеїну). В деяких варіантах втілення варіанти sAXL цього винаходу можуть бути ПЭГилированними, де полиэтиленокси групи забезпечують збільшення часу життя в кровотоці. Варіанти sAXL цього винаходу можуть бути об'єднані з іншими білками, наприклад, Fc з изотипа IgG, який може комплементарно зв'язуватися з токсином, таким як рицин, абрин, дифтерійний токсин тощо, або зі специфічними зв'язуючими агентами, які дозволяють націлюватися на конкретні фрагменти на клітинах-мішенях.

В деяких варіантах втілень варіанти sAXL цього винаходу є гібридним білком, наприклад, злитим з другим поліпептидом. В деяких варіантах втілень другий поліпептид здатний збільшити розмір гібридного білка, наприклад, таким чином, що гібридний білок не буде швидко виведений з циркуляції. В деяких інших варіантах втілень другий поліпептид є частиною або всією областю Fc. В деяких інших варіантах втілень другий поліпептид є будь-яким підходящим поліпептидом, який є по суті подібним з Fc, наприклад, забезпечуючи збільшений розмір і/або додаткове зв'язування або взаємодію з молекулами Ig. Ще в деяких інших ва�кім сироватковим альбуміном.

В деяких інших варіантах втілень другий поліпептид корисний для вдосконалення варіантів sAXL, наприклад, очищення варіантів sAXL або для підвищення їх стійкості in vitro або in vivo. Наприклад, варіанти sAXL цього винаходу можуть бути об'єднані з частинами константних доменів імуноглобуліну (IgG), в результаті чого виходять химерні або гібридні поліпептиди. Ці гібридні білки полегшують очищення і характеризуються підвищеним часом напіврозпаду in vivo. Один заявлений приклад описує химерні білки, що складаються з перших двох доменів людського CD4-поліпептидів і різних доменів константних областей важких або легких ланцюгів імуноглобулінів ссавців. ЕР А 394827; Trauneckeretal., Nature, 331:84-86, 1988. Гібридні білки з дисульфидно-пов'язаними димерними структурами (у зв'язку з наявністю IgG) також можуть бути більш ефективними у зв'язуванні і нейтралізації інших молекул, ніж мономерний секретируемий білок або один фрагмент білка. Fountoulakis et al., J. Biochem. 270:3958-3964, 1995.

В деяких інших варіантах втілень другий поліпептид є маркерної послідовністю, таким як пептид, який сприяє очищенню гібридного поліпептиду. Наприклад, маркерна амінокислотна послідовно�зокрема, багато з яких доступні в продажу. Як описано в Gentz et al., Proc. Natl. Acad. Sci. USA 86:821-824, 1989, такий гексагистидин, наприклад, забезпечує зручну очищення гібридного білка. Інший пептидний маркер, корисний для очищення, "НА" маркер, відповідає эпитопу, отриманого від білка гемаглютиніну грипу. Wilson et al., Cell 37:767, 1984.

В деяких інших варіантах втілень другий поліпептид корисний для поліпшення характеристик варіантів sAXL цього винаходу. Наприклад, в області додаткових амінокислот, особливо заряджені амінокислоти, що можуть бути додані до N-кінця поліпептиду для підвищення стабільності і стійкості під час очищення від клітини-хазяїна або подальшої обробки і зберігання. Крім того, пептидні групи можуть бути додані варіанти sAXL винаходу для полегшення очищення і згодом видалені до остаточної підготовки поліпептиду. Крім того, пептидні фрагменти для полегшення обробки поліпептидів відомі в звичайних методиках досліджень.

В деяких варіантах втілень варіанти sAXL цього винаходу мають активність зв'язування з GAS6, що, щонайменше, дорівнює або краще, ніж у дикого типу AXL. В деяких інших варіантах втілень варіанти sAXL настоящ�а, в 4 рази, в 5 разів або в 6 разів більше, ніж у дикого типу AXL. В деяких інших варіантах втілень варіанти sAXL цього винаходу мають активність зв'язування або спорідненість до GAS6, щонайменше, близько 1×10-6, 1×10-7, 1×10-8або 1×10-9М. В деяких інших варіантах втілень варіанти sAXL винаходу здатні інгібувати, пригнічувати або конкурувати з диким типом AXL за зв'язування з GAS6 in vivo, in vitro, або і так і так. Ще в деяких інших варіантах втілень варіанти sAXL цього винаходу інгібують або конкурують зі зв'язуванням AXL S6-1, AXL S6-2, та/або AXL S6-5, як це показано в прикладі 2 цього опису. В деяких інших варіантах втілень варіанти sAXL цього винаходу інгібують або конкурують зі зв'язуванням з будь-яким варіантом sAXL, як це показано в прикладі 2 цього опису.

Здатність молекули зв'язуватися з GAS6 може бути визначена, наприклад, за оцінкою здатності передбачуваного ліганду зв'язуватися з пластиною, покритої GAS6. В одному з варіантів втілень активність зв'язування варіантів sAXL цього винаходу з GAS6 може бути проаналізована за іммобілізації лігандів, наприклад, GAS6 або варіанти sAXL. Наприклад, аналіз може включати в себе имм� додано у відповідний буфер і кульки інкубують протягом певного періоду часу при заданій температурі. Після відмивки, призначеної для видалення незв'язаного матеріалу, пов'язаний білок може бути звільнений, наприклад, SDS (додецилсульфатом натрію), буфером з високим рН і подібними агентами, і проаналізований.

В інших варіантах втілень варіанти sAXL цього винаходу мають більш високу термічну стабільність, ніж термічна стабільність дикого типу AXL. В деяких варіантах втілень температура плавлення варіантів sAXL цього винаходу не менш, ніж на 5°, 10°, 15°С або 20°С вище температури плавлення дикого типу AXL.

У відповідності з цим винаходом варіанти sAXL цього винаходу також можуть включати одну або декілька модифікацій, які не змінюють первинної послідовності варіантів sAXL цього винаходу. Наприклад, такі модифікації можуть включати в себе хімічні перетворення поліпептидів, наприклад, ацетилювання, амідування, карбоксилирование і т. д. Такі модифікації можуть також включати модифікації глікозилювання, наприклад, зроблені шляхом зміни патерну глікозилювання поліпептиду в ході синтезу і процесингу, або в ході подальших кроків обробки; наприклад, піддаючи поліпептид дії ферментів, які у�х варіантах втілень варіанти sAXL цього винаходу включають варіант sAXL з фосфорилированними амінокислотними залишками, наприклад, фосфотирозином, фосфосерином або фосфотреонином.

В інших варіантах втілень варіанти sAXL цього винаходу включають варіанти sAXL додатково модифіковані для поліпшення їх стійкості до протеолітичної деградації або для оптимізації властивостей розчинності, або щоб зробити їх більш придатними в якості терапевтичного засобу. Наприклад, варіанти sAXL цього винаходу включають аналоги варіанти sAXL, що містить залишки, що відрізняються від природних L-амінокислот, наприклад, D-амінокислоти або не зустрічаються в природі синтетичні амінокислоти. D-амінокислотами можуть бути замінені деякі або всі з амінокислотних залишків.

В деяких інших варіантах втілення варіанти sAXL цього винаходу включають щонайменше два однакових або різних варіанти sAXL, пов'язаних ковалентно або нековалентно. Наприклад, в деяких варіантах втілення варіанти sAXL цього винаходу включають два, три, чотири, п'ять або шість однакових, або різних варіантів sAXL, ковалентно пов'язаних, наприклад, так, що вони будуть мати відповідні розміри, щоб уникнути небажаної агрегації.

У відповідності з цим винаходом варіанти�х у цій галузі, наприклад, проводиться з эукариотических або прокариотических клітин, синтезуватися in vitro і т. д. Якщо білок виробляється з прокариотических клітин, він може бути додатково оброблений для розгортання, наприклад, теплової денатурацією, відновлення DTT і т. д., і використовуючи способи, відомі в цій галузі, може бути знову згорнуть.

Поліпептидів можуть бути отримані в синтезі in vitro, використовуючи звичайні способи, відомі в даній області. Є різні комерційні апарати для синтезу, наприклад, автоматизований синтезатор від Applied Biosystems, Inc., Foster City, CA, Beckman і т. д. За допомогою синтезаторів природні амінокислоти можуть бути замінені на неприродні амінокислоти. Визначення послідовності та порядку підготовки залежатиме від зручності, економіки, необхідної чистоти і тому подібного.

Поліпептидів можуть бути виділені і очищені згідно з традиційними способами рекомбінантного синтезу. Лізат може бути отриманий з экспрессирующего господаря і очищений з використанням HPLC (високоефективної рідинної хроматографії), ексклюзивної хроматографії (гель-фільтрації), гель-електрофорезу, афінної хроматографії або іншої техніки очищення. По більшій частині композиції,�асі, переважно щонайменше близько 95% по масі, а для терапевтичних цілей, як правило, щонайменше, близько 99,5% по масі, в залежності від забруднення, пов'язаного зі способом приготування продукту і його очищенням. Як правило, відсоток буде заснований на загальному білку.

Способи, які добре відомі фахівцям у даній галузі, які можуть бути використані для конструювання векторів експресії, що містять кодують послідовності і відповідні транскрипционние/трансляційні елементи контролю. Ці способи включають, наприклад, техніку рекомбінантних ДНК in vitro, синтетичні способи і рекомбінацію/генетичну рекомбінацію in vivo. Альтернативно РНК, здатна кодувати поліпептиди, може бути хімічно синтезована. Будь фахівців в даній області може легко використовувати відомі таблиці кодонов і способи синтезу для створення прийнятної кодуючої послідовності для будь-якого з поліпептидів винаходу. Прямі способи хімічного синтезу, включають, наприклад, фосфотриэфирний спосіб Narang et al. (1979) Meth. Enzymol. 68:90-99; фосфодиэфирний спосіб Brown et al. (1979) Meth. Enzymol. 68:109-151; диэтилфосфамидний спосіб Beaucage et al. (1981) Tetra. Lett, 22:1859-1862; a також синтез на твердій підкладці з пате�чную ДНК шляхом гібридизації з комплементарної послідовністю, або полімеризації ДНК-полімеразою з використанням однієї нитки в якості матриці. В той час як хімічний синтез ДНК часто обмежений послідовністю близько 100 підстав, великі послідовності можуть бути отримані шляхом лігування коротких послідовностей. Крім того, підпослідовності можна клонувати і відповідні підпослідовності розщеплювати з допомогою відповідних ферментів рестрикції.

Нуклеїнові кислоти можуть бути виділені і отримані в істотному ступені чистоти. Як правило, нуклеїнові кислоти, такі як ДНК або РНК, можуть бути отримані у вигляді, який в значній мірі вільний від домішок інших природних послідовностей нуклеїнових кислот, і зазвичай має не менше 50%, щонайменше, близько 90% чистоти. Як правило, вони також є "рекомбінантними", наприклад, фланкировани одним або кількома нуклеотидами, які зазвичай не пов'язані з існуючими хромосомами. Нуклеїнові кислоти винаходу можуть бути представлені як лінійна молекула або як кільцева молекула, і можуть бути представлені у складі автономно реплицирующихся молекул (векторів), або в складі молекул без послідовності для реплікації. Експресією, відомими в даній галузі. Нуклеїнові кислоти винаходу можуть бути введені у відповідні клітини-господарі, використовуючи різні доступні в цій області способи, такі як трансферрин поликатион-опосередкований ДНК перенесення, трансфекція з «голими» або інкапсульованими нуклеїновими кислотами, ліпосом-опосередкований перенесення ДНК, внутрішньоклітинний транспорт ДНК на покритих латексом кульках, гібридизація протопластів, вірусна інфекція, електропорація, генна гармата, опосередкована фосфатом кальцію трансфекція, тощо.

В деяких варіантах втілення цього винаходу пропонуються експресують вектори для in vitro або in vivo експресії одного або декількох варіантів sAXL цього винаходу, або постійно, або під контролем одного або декількох регуляторних елементів. В деяких варіантах втілення цього винаходу передбачається клітинна популяція, що містить один або кілька векторів експресії для експресії варіантів sAXL щодо винаходу, або постійно, або під контролем одного або декількох регуляторних елементів.

Згідно іншого аспекту винаходу воно забезпечує виділені антитіла або їх фрагменти, які специфическиК-залежних білків плазми. GAS6 володіє високою структурною гомологією з природним антикоагулянтом білком S, розділяючи ті ж модульні композиції, і має 40% ідентичності між послідовностями. GAS6 має властивості подібні фактору зростання шляхом його взаємодії з рецептором тирозинкінази з сімейства ТАМ; Tyro3, AXL і MerTK. Білок Gas6 людини містить 678 амінокислот, і складається з гама-карбоксиглутамат (GLA) - багатого домену, який опосередковує зв'язування фосфоліпідів мембран, чотирьох доменів, подібних епідермального фактору росту та двох ламінін G-подібних (LG) доменів. З послідовністю транскрипційних варіантів людського GAS6 можна ознайомитися у Genbank під номерами доступу NM_001143946.1; NM_001143945.1; і NM_000820.2 відповідно.

GAS6 використовує унікальний механізм дії, взаємодіючи через вітамін К-залежний GLA (гамма-карбоксиглутаминовая кислота) модуль з фосфатидилсерин-містять мембранами, і через карбокси-термінал LamG домени з рецепторами ТАМ мембрани.

У відповідності з цим винаходом виділені антитіла цього винаходу включають будь-які виділені антитіла з впізнаваною специфічність зв'язування з GAS6. В деяких варіантах втілень виділені антитіла - частково або цілком поліклональні антитіла. В деяких інших варіантах втілень виділені антитіла являють собою химерні антитіла, наприклад, з константними ділянками, вариабельними областями та/або CDR3, або їх комбінації з різних джерел. В деяких інших варіантах втілень виділені антитіла містять комбінацію різних ознак, описаних у цьому документі.

У відповідності з цим винаходом фрагменти виділених антитіл цього винаходу включають поліпептид, що містить ділянку антитіла (або в межах каркаса антитіла, в межах іншого каркаса (не антитіла)), який є достатнім і необхідним для розпізнавання і специфічного зв'язування поліпептиду з GAS6. В деяких варіантах втілень фрагменти виділених антитіл цього винаходу включають вариабельние легкі ланцюги, вариабельние важкі ланцюги, одну або кілька CDR важких ланцюгів або легких ланцюгів, або їх комбінації, наприклад. Fab, Fv і т. д. В деяких варіантах втілень фрагменти виділених антитіл цього винаходу включають поліпептид, що містить одноцепочечное антитіло, наприклад, ScFv. В деяких варіантах втілень фрагменти виділених антитіл цього винаходу включають тільки вариабельние тах втілень фрагменти виділених антитіл цього винаходу включають миниантитела, наприклад, VL-VH-CH3 або биантитела.

В деяких варіантах втілень виділені антитіла цього винаходу зв'язуються з эпитопом містить, або представленим одним або кількома амінокислотними ділянками, які взаємодіють з AXL. В деяких інших варіантах втілень виділені антитіла цього винаходу зв'язуються з эпитопом складається з, або представленим одним або кількома амінокислотними ділянками GAS6, наприклад, L295-T317, Е356-Р372, R389-N396, D398-A406, Е413-Н429 і W450, М468 з GAS6.

В деяких інших варіантах втілень виділені антитіла цього винаходу зв'язуються з эпитопом містить, або представленим одним або кількома амінокислотними ділянками, наприклад, LRMFSGTPVIRLRFKRLQPT (SEQ ID NO:3), EIVGRVTSSGP (SEQ ID NO:4), RNLVIKVN (SEQ ID NO:5), DAVMKIAVA (SEQ ID NO:6), ERGLYHLNLTVGIPFH (SEQ ID NO:7) і WLNGEDTTIQETVVNRM (SEQ ID NO:8).

В деяких інших варіантах втілень виділені антитіла цього винаходу зв'язуються з эпитопом, що містить, або представленим, щонайменше, однією, двома, трьома, чотирма, п'ятьма або шістьма амінокислотами в області L295-T317, Е356-Р372, R389-N396, D398-A406, Е413-Н429 і W450-M468 з GAS6. В деяких інших варіантах втілень виділені антитіла цього винаходу зв'язуються з эпитопом, соді�ласті LRMFSGTPVIRLRFKRLQPT (SEQ ID NO:3), EIVGRVTSSGP (SEQ ID NO:4), RNLVIKVN (SEQ ID NO:5), DAVMKIAVA (SEQ ID NO:6), ERGLYHLNLTVGIPFH (SEQ ID NO:7) і WLNGEDTTIQETVVNRM (SEQ ID NO:8).

У ще кількох інших варіантах втілень виділені антитіла цього винаходу здатні інгібувати, пригнічувати або конкуровать зі зв'язуванням між GAS6 і диким типом AXL або варіантами sAXL цього винаходу.

У відповідності з цим винаходом і варіанти sAXL і виділені антитіла цього винаходу можуть бути представлені у фармацевтичній композиції, підходящою для терапевтичного використання, наприклад, для лікування людини. В деяких варіантах втілень фармацевтичні композиції по справжньому винаходу включають один або кілька терапевтичних суб'єктів цього винаходу, наприклад, варіанти sAXL та/або виділені антитіла проти GAS6 або фармацевтично прийнятні солі, складні ефіри або сольвати, або проліки. В деяких інших варіантах втілень фармацевтичні композиції по справжньому винаходу включають один або кілька терапевтичних суб'єктів винаходу в поєднанні з іншим цитотоксичним агентом, наприклад, іншим протипухлинною агентом. В деяких інших варіантах втілень фармацевтичні композиції за настоящ�ацевтически прийнятним наповнювачем.

В деяких інших варіантах втілень терапевтичні суб'єкти винаходу часто вводять у вигляді фармацевтичної композиції, що містить, наприклад, активний терапевтичний засіб і цілий ряд інших фармацевтично прийнятних компонентів. (Див. Remington's Pharmaceutical Science, 15.sup.th ed., Mack Publishing Company, Easton, Pa., 1980.) Краща форма залежить від передбачуваного способу введення і терапевтичного застосування. Композиції можуть також включати, залежно від бажаної лікарської форми, фармацевтично прийнятні нетоксичні носії або розріджувачі, які визначені в якості засобів, широко використовуються в розробці фармацевтичних композицій для лікування тварин або людини. Розріджувач вибрано так, щоб не впливати на біологічну активність комбінації. Прикладами таких розріджувачів є дистильована вода, фізіологічний фосфатний буферний розчин, розчин Рінгера, розчин декстрози та розчин Хенка. Крім того, фармацевтична композиція або рецептура може також включати інші носії, ад'юванти або нетоксичні, нетерапевтические, неиммуногенние стабілізатори тощо.

В деяких інших варіантах втілень фармацевтичні композиції з нас�і, полісахариди, такі як хітозан, полимолочние кислоти, полигликолевие кислоти і сополімери (як латекс функционализированная Sepharose™, агароза, целюлоза тощо), полімерні амінокислоти, сополімери амінокислот, і ліпідні агрегати (як масляні краплі або ліпосоми). Крім того, ці носії можуть функціонувати як імуностимулюючих агентів (наприклад, ад'юванти).

Згідно ще одному іншого аспекту винаходу, воно надає способи лікування, зменшення або запобігання метастазування пухлини або інвазії пухлини шляхом інгібування шляху AXL сигналізації та/або GAS6 сигнального шляху. В деяких варіантах втілень способи цього винаходу включають інгібування активності AXL, активності GAS6 або взаємодії між AXL та GAS6. Наприклад, активність AXL або GAS6 може бути ингибирована на рівні експресії генів на рівні процесингу мРНК, на рівні трансляції, на посттрансляционном рівні, на рівні активації білка і т. д. В деяких інших прикладах активність AXL або GAS6 може бути ингибирована допомогою малих молекул, біологічних молекул, таких як поліпептиди, полінуклеотиди, антитіла, кон'югати антитіл і ліків і т. д. В деяких інших прикладах� цього винаходу.

В інших варіантах втілень способи цього винаходу включають введення суб'єкту, потребує лікуванні, терапевтично ефективного кількості або ефективної дози терапевтичних об'єктів цього винаходу, наприклад, інгібітор активності AXL або GAS6 активності, або інгібітора взаємодії між AXL та GAS6. В деяких варіантах втілень ефективні дози терапевтичних об'єктів цього винаходу, наприклад, для лікування метастатичного раку, описані тут, міняються в залежності від різних факторів, включаючи спосіб введення, цільової сайт, фізіологічний стан пацієнта, будь то хвора людина або тварина, застосування інших препаратів, і чи є лікування профілактичним або терапевтичним. Як правило, пацієнт є людиною, але також можна лікувати ссавців, не є людиною, включаючи трансгенних тварин. Лікувальну дозу необхідно титрувати для оптимізації ефективності та безпеки.

В деяких варіантах втілень дозування може варіюватися від 0,0001 до 100 мг/кг, а найчастіше від 0,01 до 5 мг/кг ваги тіла господаря. Наприклад, доза може бути 1 мг/кг маси тіла або 10 мг/кг маси тіла, або в межах 1-10 мг/кг Зразків. �ерапевтические суб'єкти цього винаходу зазвичай вводять по кілька разів. Інтервали між окремими дозами можуть бути тижневими, місячними або річними. Інтервали можуть бути нерегулярними, як показано шляхом вимірювання рівнів у крові пацієнта терапевтичного суб'єкта. Крім того, терапевтичні суб'єкти цього винаходу можуть бути введені з уповільненим вивільненням, у цьому випадку частота введення нижче. Дозування та частота змінюються в залежності від періоду напіврозпаду поліпептиду у пацієнта.

У профілактичних програмах відносно низькі дози вводять у відносно рідкісні інтервали протягом тривалого періоду часу. Деякі пацієнти продовжують отримувати лікування до кінця свого життя. В терапевтичних цілях іноді потрібно вводити відносно високі дози в порівняно короткі проміжки часу до зменшення або припинення прогресування захворювання, і, бажано, поки пацієнт не показує часткове або повне поліпшення симптомів захворювання. Після цього пацієнт може бути переведений на профілактичний режим.

В інших варіантах втілень способи цього винаходу включають лікування, зменшення або запобігання мо�лстой кишки, раку жовчного міхура, рак підшлункової залози, раку простати та/або гліобластоми.

В деяких інших варіантах втілення для профілактичного застосування фармацевтичні композиції або медикаменти вводяться пацієнтові, піддана або знаходиться в групі ризику розвитку захворювання або стану, в кількості, достатній для усунення або зниження ризику, зменшення ваги, або для того, щоб відстрочити початок захворювання, у тому числі біохімічні, гістологічні та/або поведінкові симптоми хвороби, її ускладнення і проміжний патологічний фенотип, що виникає в процесі розвитку хвороби.

В деяких інших варіантах втілення для терапевтичного застосування терапевтичні об'єкти цього винаходу вводять пацієнтові, з підозрою на наявність або вже страждає від такої хвороби в кількості, достатній, щоб вилікувати, або, щонайменше, частково затримати симптоми захворювання (біохімічні, гістологічні та/або поведінкові), в тому числі його ускладнень і розвиток проміжного патологічного фенотипу захворювання. Кількість, адекватне для досягнення лікувального або профілактичного лікування визначається, як терапевтично або профі�я в декілька доз, поки достатній відповідь буде досягнутий.Як правило, відповідь контролюється і даються повторювані дози, якщо є рецидив раку.

У відповідності з цим винаходом композиції для лікування метастатичного раку можна вводити парентерально, місцево, внутрішньовенно, внутрішньопухлинно, орально, підшкірно, внутрішньоартеріально, внутричерепно, внутрішньочеревно, інтраназально або внутрішньом'язово. Найбільш типові шляхи введення - внутрішньовенно або внутрішньопухлинно, хоча інші шляхи можуть бути однаково ефективними.

Для парентерального введення композиції винаходу можуть бути введені, як ін'єкційні дози розчину або суспензії речовини в фізіологічно прийнятному розчиннику з фармацевтичним носієм, який може бути стерильною рідиною, наприклад, водою, олією, фізіологічним розчином, гліцерином або етанолом. Крім того, допоміжні речовини, такі як зволожуючі або емульгатори, поверхнево-активні речовини, рН буферні субстанції і т. п. можуть бути присутніми в композиції. Інші компоненти фармацевтичних композицій є речовинами нафтового, тваринного, рослинного або синтетичного походження, наприклад, арахісова олія, соєва олія і нефтепродуксителями, зокрема, для розчинів для ін'єкцій. Антитіла можуть бути введені у вигляді ін'єкції депо препарату або імплантату, який може бути утворений таким чином, щоб можна було забезпечити уповільнене вивільнення діючої речовини. Типова композиція містить моноклональні антитіла в дозі 5 мг/мл, поміщені у водний буфер, що складається з 50 мМ L-гістидину, 150 мМ NaCl, доведений до рН 6,0 з HCl.

Як правило, композиції готують як ін'єкції, або у вигляді рідких розчинів або суспензій; також можуть бути отримані тверді форми, придатні для розчинення або суспендування в рідких засобах, до ін'єкції. Препарат також може бути эмульгированним або инкапсулированним в ліпосоми, або мікрочастинки, такі як полилактид, полигликолид або сополімер для поліпшення ад'ювантної ефекту, як описано вище. Longer, Science 249:1527, 1990 and Hanes, Advanced Drug Delivery Reviews 28:97-119, 1997. Агенти цього винаходу можна вводити у вигляді ін'єкції депо препарату або імплантату, який може бути сформований таким чином, щоб можна було отримати постійне або пульсуюче вивільнення активного інгредієнта.

Додаткові форми, придатні для інших видів застосування, включають оральні, інтраназальні і легеневі фор�алкиленгликоли або тригліцериди; такі свічки можуть бути утворені із сумішей, що містять активний інгредієнт в діапазоні від 0,5 до 10%, переважно 1-2%. Оральні форми містять наповнювачі, такі як фармацевтичного якості манітол, лактозу, крохмаль, магнію стеарат, натрію сахарин, целюлозу і карбонат магнію. Ці композиції вживають у формі розчинів, суспензій, таблеток, драже, капсул, форм з тривалим вивільненням або порошків, що містять 10%-95% активного інгредієнта, переважно 25-70%.

Місцеве застосування може призвести до трансдермальною або внутрішньошкірної доставці. Місцевим введення може сприяти одночасне призначення агента з холерним токсином або знешкоджених похідними, або їх субодиницями або іншими подібними бактеріальними токсинами. Glenn et al., Nature 391:851, 1998. Сумісне введення може бути досягнуто з допомогою компонентів у суміші або у вигляді зв'язаних молекул, отриманих шляхом хімічного зшивання або експресованих у вигляді гібридного білка.

Крім того, трансдермальна доставка може бути досягнута за допомогою шкірних пластирів або з допомогою трансферосом Paul et al., Eur. J. Immunol. 25:3521-24, 1995; Cevcetal., Biochem. Biophys. Acta 1368: 201-15, 1998.

Фармацевтичні композиції, як правило, составляютсѻя якості (GMP) адміністрації США з продовольства і медикаментів.

Переважно терапевтично ефективні дози композицій антитіл, описані тут, будуть забезпечувати терапевтичний ефект, не викликаючи істотною токсичності.

Токсичність білків, описаних тут, може бути визначена за стандартним фармацевтичним процедур у клітинних культурах або на експериментальних тварин, наприклад, шляхом визначення LD50(смертельна доза для 50% популяції) або LD100(смертельна доза для 100% популяції). Співвідношення доз між токсичним і лікувальними ефектами є терапевтичним індексом. Дані, отримані в дослідженні на цих клітинних культурах і тварин, можуть бути використані в розробці інтервалу доз, які не токсичні для використання у людини. Дозування білків, описаних тут, знаходиться переважно в діапазоні концентрацій циркулюючих, які включають ефективну дозу і практично або зовсім не токсичні. Дозування може змінюватись в межах цього діапазону в залежності від лікарської форми і використовуваних шляхів введення. Точна пропис, спосіб застосування та дози можуть бути обрані лікуючим лікарем з урахуванням стану пацієнта. (Див., наприклад, Fingl et al., 1975, In: The Pharmacological Basis of Therapeutics, Ch. 1).

Кромех препарати) винаходи і інструкції по застосуванню. Набори можуть також містити як мінімум один додатковий реагент. Набори зазвичай включають в себе ярлик із зазначенням передбачуваного використання вмісту набору. Цей термін включає будь-які етикетки в письмовій формі, або записані супроводжуючі матеріали, або в наборі, або які іншим чином супроводжують набір.

Згідно ще одного аспекту винаходу, пропонуються способи для визначення здатності пухлини до пухлинної інвазії та/або метастазування шляхом виявлення та/або визначення рівня активності AXL або активності GAS6 в біологічних образах, що представляють інтерес. В певному варіанті втілення рівень активності AXL або активності GAS6 вимірюється за рівнем експресії мРНК, рівнем експресії білка, рівня активації білка або будь відповідним індикатором відповідної активності AXL або GAS6 прямо або побічно. В деяких варіантах втілень рівень AXL активності або GAS6 активності в біологічному зразку далі порівнюється з певним рівнем, наприклад, стандартним рівнем, отриманим шляхом встановлення нормального рівня або діапазону активності AXL, або GAS6 активності, заснованої на популяції зразків пухлин, де не розвивається пухлинна ін�ти GAS6 більше, чим зумовлений рівень або стандартний рівень свідчить про схильності пухлини до пухлинної інвазії або метастазування пухлини.

Всі публікації та патенти, наведені в цьому описі, включені тут в якості посилання, як якщо б кожна публікація або патент були спеціально і індивідуально вказані, повинні бути включені за посиланням і включені сюди шляхом посилання на виявлення і опис способів та/або матеріалів, у зв'язку з чим наводяться публікації. Цитування з будь публікації розкритою до дати подачі заявки не повинно бути витлумачено, як визнання того, що даний винахід не має пріоритету заднім числом на такі публікації до набрання чинності винаходу. Крім того, дати публікацій умовні, і можуть відрізнятися від фактичної дати публікації, для якої, можливо, буде потрібно незалежне підтвердження.

Як буде ясно фахівцям в даній області при читанні цього опису, кожне окреме втілення, описане та проілюстрований тут, має дискретні компоненти і функції, які можуть бути легко відокремлені від або в поєднанні з особливостями будь-якого іншого або кількох втілень, не відходячи від обсягу або духу справжнього изобретелогически можливе. В подальшому будуть описані приклади для ілюстрації частин винаходу.

Експериментальна частина

Приклад 1.

Терапевтична блокада AXL сигналізації пригнічує метастатичне прогресування пухлини.

Раніше AXL, в якості терапевтичної мішені для лікування метастатичного захворювання був практично не досліджений, а головне в умовах in vivo не було продемонстровано зв'язок з націленням на AXL. Ми показали, що AXL є маркером метастазування у пацієнтів з раком молочної залози та у пацієнтів з раком яєчників, і тяжкість захворювання у цих пацієнтів корелює з кількістю білка AXL в первинної пухлини. Найголовніше, ми показали, що метастазування пухлини може успішно лікуватися у мишей, у яких вже є метастазування, шляхом введення розчинних эктодоменов AXL. Механістично, інгібування AXL сигналізації у тварин з метастатичною хворобою призводить до зниження інвазії і активності ММР. Наші результати показують, що інгібування сигнального каскаду AXL в пухлинних клітинах шляхом введення розчинних эктодоменов AXL достатньо для інгібування метастатичної прогресії пухлини.

У цьому дослідженні ми вивчали, чи є AXL критичним �им засобом для лікування метастатичного захворювання. Ми використовували як генетичні, так і терапевтичні підходи, щоб безпосередньо оцінити роль AXL в ініціації та прогресуванні метастатичного раку молочної залози і раку яєчників.

AXL є маркером прогресування пухлини та метастазування раку людини. Ми вперше порівняли експресію AXL в нормальних тканинах, первинної пухлини і метастази у хворих з раком молочної залози або рак яєчників. У 100% нормальних епітеліальних клітин, прилеглих до клітин раку молочної залози, були присутні дифузне цитоплазматическое і ядерне фарбування для AXL, що було прийнято за фонове забарвлення з урахуванням того, що AXL це мембранозв'язані рецептори (n=27, фігура 1). Проте в первинних пухлинах молочної залози мембранне фарбування AXL пухлини епітелію присутня у 25% (1/4) 1-й стадії, 76% (10/13) 2 стадії, і 100% (18/18) 3-й стадії зразків (фігура 1А і таблиця 1). Крім того, AXL була экспрессирована у 88% (8/9) метастазів в лімфатичних вузлах.

В серозних зразках раку яєчників AXL експресія вперше була розглянута у нормальному епітелії поверхні яєчників (OSE), так як більшість пухлин яєчників, як вважають, виникають з цих клітин. У зразках пацієнтів з раком яєчників, які сохраних AXL в первинної пухлини епітелію були присутні у 66% (6/9) II стадії і 83% (53/64) III стадії зразків пацієнтів (фігура 1В і таблиця I). Крім того, пухлинні зразки від загальних метастатичних сайтів, таких як сальник і черевна порожнина, показали високу експресію AXL в 75% (24/32) і 90% (27/30) зразків відповідно (фігура 1В і таблиця I). Ці дані показують, що AXL експресія первинної пухлини корелює з метастазуванням, як показано на пізніх стадіях захворювання і метастатичних пухлинах. Крім того, ці дані показують, що метастази, отримані з людської молочної залози і раку яєчників, експресують високий рівень AXL.

AXL є критичним фактором для метастазування пухлини. Для вивчення функціональної ролі AXL у метастазуванні, ми використовували генетичний підхід для придушення AXL у мишачих моделях метастазування раку молочної залози і яєчників. Для цієї мети ми аналізували панель людських ліній ракових клітин молочної залози і яєчників на експресію білка AXL з метою виявлення метастазуючих клітинних ліній з високим рівнем експресії AXL. Як і у наших клінічних даних, AXL високо экспрессирована в більшості метастазуючих клітинних ліній раку молочної залози (NCI-ADR-РЕЗ, MDA-231, HS 578T, ВТ-549) і яєчників (SKOV3, OVCAR-8, ES-2, MESOV, HEYA8), в той час як у клітинних лініях з низьким метастатиче�ицитние клітинні лінії метастатичного раку молочної залози (MDA-231) і яєчників (SKOV3ip.1 і OVCAR-8) були отримані з використанням описаних мшРНК, націлених на AXL. Вестерн-блот аналіз підтвердив, що клітини, що експресують послідовності shAXL, експресують менш ніж 5% білка AXL порівняно з клітинами, экспрессирующими контрольні scramble послідовності мшРНК (shSCRM, фігура 9В).

Щоб безпосередньо оцінити роль AXL в пізніх стадіях метастазування пухлини молочної залози, ми вводили AXL-дикого типу (shSCRM) і AXL-дефіцитні (shAXL) MDA-231 клітини в хвостову вену голою миші і оцінювали пухлинну навантаження в легенях на двадцять восьмий день. Мікроскопічна оцінка легких показала, що у 5/5 мишей, яким вводили scramble мшРНК (shSCRM) MDA-231 клітини, розвинулися метастатичні вогнища, позитивно забарвлені по AXL (фігура 2А). З іншого боку, у 0/5 мишей, яким вводили мшРНК AXL (shAXL), розвинулися метастази в легенях при гістологічну оцінку (фігура 2А). Для того, щоб кількісно оцінити пухлинну навантаження в легенях цих тварин, ми провели аналіз ПЛР у реальному часі для людського GAPDH. Фігура 2А показує, що в легенях мишей, яким вводили shSCRM MDA-231 клітини, експресується високий рівень людського GAPDH, що вказує на наявність метастазів, отриманих від MDA-231 клітин. Крім того, shSCRM ін'єктовані миші експресують людський AXL в лрим вводили shAXL пухлинні клітини, не експресують людські GAPDH або AXL в легенях. Ці результати показують, що генетичної інактивації AXL достатньо, щоб повністю придушити утворення метастазів у легенях цієї моделі.

Для визначення того, чи впливає генетична інактивація AXL здатність клітин раку яєчників до метастазування в умовах in vivo, ми порівняли здатність shSCRM і shAXL SKOV3ip.1 клітин до утворення метастазів за допомогою перитонеальній моделі ксенотрансплантата раку яєчників. Ця модель повторює перитонеальне поширення людських метастазів яєчників у миші, в якій розвивається швидко прогресуюче захворювання, що складається з асциту і понад 100 невеликих метастатичних уражень, які прикріплені до брижі, діафрагми, печінки та інших перитонеальним поверхонь після перитонеальній ін'єкції SKOV3ip.1 клітин (фігура 3В). Імуногістохімічний аналіз AXL експресії в SKOV3ip.1 перитонеальних метастазів показав, що вони схожі на метастази раку яєчників людини, AXL високо экспрессирован в SKOV3ip.1 метастатичних ураженнях, показуючи, що це релевантна модельна система для дослідження ролі AXL в метастазуванні яєчників (дані не показані). Двадцять вісім днів потому після перитонЇего було необхідно скарифікувати мишей і досліджувати зміни в пухлинної навантаженні між shSCRM і shAXL инъецированними мишами. Коли миші вводили shSCRM клітини - розвивається асцит і >100 перитонеальних метастазів, якщо миші вводили shAXL клітини - розвивалися лише кілька метастазів (фігура 2В). Середнє число перитонеальних метастазів більше 5 мм у розмірі було значно зменшено з 13,4 +/- 4.3 у shSCRM инъецированних мишей до 0,8 +/- 0,5 у shAXL инъецированних мишей (фігура 2В). Крім того, середня вага цих пухлин був значно зменшений з 236 +/- 74 мг у shSCRM инъецированних мишей до 39,2 +/-18 мг у shAXL инъецированних мишей (фігура 2В). На підтвердження цих висновків, нокдаун AXL експресії в OVCAR-8 клітинах суттєво інгібує загальну масу пухлини і число перитонеальних пухлин яєчників (фігура 2С). У сукупності ці результати показують, що AXL є критичним фактором для метастазування раку молочної залози та пухлини яєчників.

Беручи до уваги важливу роль AXL в освіті метастазів в умовах in vivo, ми в подальшому прагнули визначити, чи дійсно AXL специфічно регулює метастазування або AXL грає загальну роль в регуляції проліферації пухлинних клітин і зростання. Щоб відповісти на ці питання, ми провели in vitro аналізи проліферації, в яких загальна кількість клітин між AXL дикого типу (shSCRM) і AXL-дефіцитними (shAXLshSCRM і shAXL MDA-231, SKOV3ip.1 або OVCAR-8 клітин (фігура 3). Крім того, ніяких істотних відмінностей не спостерігається між ортотопическим MDA-231 або підшкірним SKOV3ip.1 ростом пухлини між shSCRM і shAXL клітинами (фігура 3). Ці результати показують, що AXL не потрібно для проліферації пухлинних клітин або підшкірного зростання in vivo. В цілому, наші результати показують, що AXL специфічно регулює метастазування пухлин молочної залози та пухлин яєчників.

AXL регулює пухлинну інвазію клітин. Для визначення можливих механізмів AXL-опосередкованого метастазування, ми обрали неупереджений підхід і безпосередньо порівнювали роль AXL в критичних клітинних функцій, пов'язаних з метастатичним каскадом, включаючи проліферацію, інвазію, міграцію, адгезію і виживання. Ми виявили, що shAXL MDA-231, SKOV3ip.1 і OVCAR-8 клітини були значно ослаблені в можливості інвазії через колаген типу I (фігура 4А). Ми також спостерігали невелике зниженням клітинної міграції в shAXL клітинах, але ми не змогли знайти відмінності в адгезії до ЄСМ білків або у виживанні після введення сироватки, що свідчить про те, що AXL переважно впливає на інвазію в метастатичному каскаді.

Нещодавно було визначено, що на молекулярному рівні ММР-9 являє� ММР-9 експресія або активність змінена в AXL-дефіцитних клітинах пухлин яєчника. Хоча SKOV3ip.1 клітини не экспрессировали ММР-9, ми виявили, що ММР-2 був високо экспрессирован в цих клітинах, а в клітинах shAXL мРНК ММР-2 значно знизилася (фігура 4В). Аналізи ММР-2 з репортерним ген люциферази показали, що виявлена активність промотору ММР-2 значно знизилася shAXL клітинах порівняно з клітинами shSCRM, що говорить про те, що AXL регулює ММР-2 на рівні транскрипції (фігура 4С). Желатиновий зимографический аналіз показав, що рівні секретуються білків ММР-2 були значно знижені в shAXL клітинах порівняно з shSCRM SKOV3ip.1 клітинами (фігура 4D). У сукупності ці дані свідчать про роль AXL, як підвищує регулятора експресії ММР-2 та його активності в клітинах людського раку яєчників.

Далі ми намагалися визначити сигнальні шляхи, які беруть участь у AXL-опосередкованої ММР-2 експресії. Активація AXL від GAS6, як було повідомлено, безпосередньо індукує низку внутрішньоклітинних сигнальних шляхів, у тому числі PI3K, PAS, МАРК, SRC і PLC. Серед цих шляхів, сигнальний шлях PI3K був показаний, як шлях регулювання експресії ММР-2 та інвазії в клітинах раку яєчників. Для визначення того, як PI3K сигналізація залежить від втрати AXL в SKOV3ip.1 клітинах, ми провели Вестерн-блот аналізи фосфорна-AKT на ах порівняно з shSCRM SKOV3ip.1 клітинами (фігура 4Е). Крім того, GAS6 стимуляція виснажених SKOV3ip.1 клітин в результаті PI3K залежною індукції P-AKT, такий як обробка інгібітором PI3K Ly294002, повністю скасовує GAS6 індуковану P-AKT експресію (фігура 4Е). Щоб визначити, чи є шлях PI3K залученим в AXL-опосередковану ММР-2 експресію, ми провели аналізи ММР-2 з репортерним ген люциферази в присутності GAS6 і Ly294002. Індукція ММР-2 активності промотору після стимуляції GAS6 була повністю заблокована Ly294002, що дозволяє припустити, що GAS6/AXL сигналізація регулює ММР-2 експресію через PI3K сигнальні події (фігура 4F).

Терапевтичне інгібування AXL значно пригнічує метастатичну прогресію пухлини у мишей. Наші результати показують, що AXL є критичним фактором для метастазування і підтверджують гіпотезу про те, що терапевтична блокада може бути ефективним засобом для лікування метастатичного захворювання. Щоб перевірити цю гіпотезу, ми використовували розчинні эктодомени AXL в терапевтичної стратегії для інгібування AXL сигналізації. Розчинний эктодомен AXL функціонально діє як рецептор-пастка і раніше було показано, що пов'язує GAS6 з наномолярним спорідненістю in vitro та in vivo (фігура 5А). Спочатку та інвазії метастатичних пухлинних клітин. PI3K/AKT сигналізація регулюється AXL в різних типах клітин. Ми виявили, що PI3K/AKT сигналізація регулюється GAS6/AXL сигналізацією в SKOV3ip.1 клітинах, і лікуванням розчинними эктодоменами AXL (sAXL) вдалося зменшити PI3K/AKT активацію в оброблених GAS6 клітинах SKOV3ip.1 (фігури 5В і С). Крім того, введення MDA-231 клітин у колаген з sAXL було достатньо, щоб різко скоротити клітинну інвазію, демонструючи, що використання sAXL впливає на AXL сигналізацію і інвазію in vitro (фігура 5D).

Далі ми розглянули, як введення sAXL вплине на метастатичне прогресування пухлини у високометастатической моделі раку яєчників. Спочатку ми индуцировали метастатичне ураження SKOV3ip.1 у голих мишей (день 1) і почали лікування sAXL на 7 день після перевірки макроскопічних поразок. sAXL терапія доставлялася з допомогою аденовірусної системи, при якій печінка здійснює системне вивільнення sAXL білка в сироватку крові мишей протягом 28 днів після ін'єкції (фігура 6А). Макроскопічні аналізи пухлинної маси на 28-й день показали, що у мишей, які отримували терапію sAXL було достовірне (p < 0,01) зниження пухлинної маси порівняно з мишами, які отримували Fc контрольну терапію. У моделі пухлини SKOV3ip.1, загальна маса пухлини і ѵли, загальна вага пухлини і число пухлин значно зменшилася на 47% і 42% відповідно (фігура 11). Ми розглянули рівні експресії ММР2в пухлинах SKOV3ip.l за допомогою ПЛР аналізу в реальному часі і виявили, що рівні ММР2 значно знизилися в пухлинах sAXL мишей порівняно з Fc контрольними мишами (фігура 6С). Ці результати показують, що монотерапія AXL досить істотно знизила метастатичну пухлинну навантаження у мишей з виявленим захворюванням. Крім того, наші результати показують, що терапевтичний ефект AXL на ріст пухлинних метастазів може призвести до гальмування інвазії, щонайменше, частково за рахунок регуляції активності ММР.

Враховуючи, що для попередніх антиметастатических інгібіторів, націлених на ММР, було показано, що вони мають значний вплив на нормальні тканини в плані токсичності, ми провели комплексний аналіз токсичності для нормальної тканини у мишей, що отримували терапію sAXL протягом 21 дня. Ми не спостерігали поведінкових, або макроскопічних мікроскопічних відхилень у голих мишей, які отримували sAXL або Fc терапії (фігура 7).

Інвазія і міграція є важливими внутрішньоклітинними властивостями, які сприяють патогенезу метастазиров�ь корисною стратегією для пригнічення метастазування і можуть забезпечити клінічний ефект у пацієнтів з метастатичною хворобою. Нами було показано, що рецептор тирозинкінази AXL є критичним фактором, що визначає здатність клітини до пухлинної інвазії і метастазування. Найголовніше, ми показали, що терапевтична блокада AXL сигналізації з використанням розчинних рецепторів AXL досить суттєво інгібує метастатичне прогресування пухлини у мишей, у яких вже є метастатичне захворювання. Механістично наші дослідження показують, що терапія розчинним AXL пригнічує метастазування пухлини, щонайменше, частково за рахунок інгібування активності ММР та інвазії. Нарешті ми показали, що AXL сильно экспрессирован в метастазах на просунутій стадії первинної пухлини пацієнтів з раком яєчників і рак молочної залози, що підкреслює клінічне значення наших висновків.

Тут показано, що AXL є критичним фактором для метастазування раку у людини, і що терапевтична блокада AXL сигналізації є ефективною для лікування метастатичного захворювання. Також ми показуємо, що AXL сильно экспрессирован в метастазах та досвідчених зразках первинних пухлин молочної залози та хворих на рак яєчників. Ми показуємо, що генетично AXL має решающнних на модельних організмах - голих мишей. Найголовніше, ми розробили досить специфічні і нетоксичні розчинні рецептори AXL, в якості анти-AXL терапії, і продемонстрували, що терапія розчинним рецептором AXL досить суттєво гальмує метастатичне прогресування пухлини у мишей з існуючою метастатичною хворобою. Наші результати показують, що інгібування сигнального каскаду AXL в пухлинних клітинах може заблокувати як ініціацію, так і прогресування метастатичної хвороби. Наші дані увазі AXL, як нову терапевтичну мішень для просунутих стадій і метастатичного раку молочної залози і раку яєчників, і припускають, що анти-AXL терапія може контролювати і ініціацію, і прогресування метастатичного захворювання.

ММР відіграють важливу роль у регуляції інвазії клітин пухлини та метастазування. Тим не менш, механізми, за допомогою яких пухлинні клітини індукують активність ММР, залишаються неясними. ММР експресія збільшується при раку у людини і корелює з прогресією пухлини і поганий виживаністю пацієнтів. Ампліфікації гена і активують мутації в ММР рідко зустрічаються при людському раку, що дозволяє припускати, що інші фегулируется AXL на рівні транскрипції в клітинах людського раку яєчників. Хоча точний механізм, за допомогою якого AXL регулює експресію ММР-2, ще належить визначити, показано, що фармакологічна інгібування PI3K шляху знижує активність промотору ММР-2 в GAS6 стимульованих клітинах, що вказує на роль PI3K шляху (фігура 8). Важливо зазначити, що наші результати показують, що терапевтична блокада AXL може бути ефективною і нетоксичної стратегією для придушення активності ММР в пухлинах. Широкий спектр інгібіторів ММР виявився невдалим при випробуваннях в лікуванні раку, зокрема у зв'язку з високим рівнем токсичності для нормальної тканини. Наші результати показують, що передбачувані побічні ефекти анти-AXL терапії є мінімальними. Ми не спостерігали токсичність для нормальних тканин, пов'язану з аденовірус-опосередкованої доставкою розчинної AXL эктодомена при терапії у мишей. Крім того, зародкові лінії клітин AXL та GAS6 мишей є життєздатними і фенотипічно нормальні, як і дорослі, що дозволяє припустити, що AXL або GAS6 не потрібно для розвитку і нормального функціонування тканин.

Ми показали, що монотерапія AXL достатня для пригнічення метастатичного прогресування пухлини у високометастатических моделяѸмерно 14 600 чоловік вмирають від раку яєчників щорічно в Сполучених Штатах. В даний час немає схвалених FDA біологічних способів для лікування раку яєчників, хоча Авастин (mAb націлений VEGF) і Тарцева (маленька молекула інгібітор EGFR кінази) використовуються в клінічних дослідженнях для лікування поширеного і рецидивуючого раку яєчників. Стандартна терапія раку яєчників включає в себе операції з оптимальним видаленням поразки і подальшої цитотоксичною комбінованою терапією платина-таксан. Незважаючи на ці зусилля, у вісімдесяти відсотків пацієнтів з діагнозом рак яєчників розвивається рецидив захворювання і тільки 30% з цих пацієнтів виживають протягом 5 років після постановки діагнозу.

Наші дані показують, що AXL терапія є ефективною ад'ювантної терапією для лікування поширеного і рецидивуючого раку яєчників. Модель метастатичної прогресії пухлини яєчників, використовувана в наших дослідженнях, нагадує розвиток рецидиву захворювання у хворих після хірургічного видалення. Ми виявили, що AXL терапії вдалося знизити метастатичну пухлинну навантаження у мишей з виявленим захворюванням на 63%. Створення нових метастатичних уражень під час прогресування захворювання значно знизилося. Це н�і, а не клітинну проліферацію або зростання. Взяті разом, наші результати показують, що терапія AXL функціонує головним чином, як антиметастатический агент і може бути найбільш ефективним у комбінованій терапії з поточними цитотоксичними агентами.

Таким чином, AXL є критичним фактором для метастазування, і блокада AXL сигналізації має позитивну терапевтичну дію при метастазуванні. Ці дослідження є важливими доклінічними даними по анти-AXL терапії для метастатичної хвороби.

Способи

Клітинні лінії. Клітини яєчників SKOV3, SKOV3ip.1 і HEYA8 були отримані в подарунок від Dr. Gordon Mills (MD Anderson Cancer Center). Клітини яєчників ES-2 і MESOV - в подарунок від Dr. Branimir Sikic (Стенфордський університет). MDA-231, OVCAR-3 та MCF-7 клітини були отримані від АТСС. IGROV-1 і OVCAR-8 клітини були придбані у NCI-Frederick DCTD сховища клітинної лінії пухлин. Клітини культивують у відповідних середовищах з додаванням 10% термоинактивированной ембріональної телячої сироватки та 1% пеніциліну і стрептоміцину при 37°С у 5% CO2-інкубаторі. Клітинна маса з NCI60 панелі ліній ракових клітин молочної залози і яєчників були надані Dr. Giovani Melillo (NCI-Frederick).

Пацієнти і тканини мікрочіпів. Мікрочіпи отримані з відділення патології Стенфордського університету. У загальній складності 73 парафинированних зразка пухлин були отримані раніше від хворих на рак яєчників Стенфордської лікарні з 1995 по 2001 рік на той момент ще не отримували лікування. Ці первинні зразки пухлин яєчників були зібрані в тканинній мікрочіп, який містить два зразка від кожного пацієнта. Ще 30 зразків пухлин черевної порожнини були оцінені в цьому мікрочип. Всі пацієнти мали серозний рак яєчників, інформація була отримана у відповідності зі стандартами Міжнародної федерацією гінекології та акушерства. Всі зразки і відповідні клінічні дані були зібрані згідно з протоколами, затвердженими експертною радою організації в Стенфордському університеті. Додаткові комерційно доступні мікрочіпи пухлини були використані для вивчення 32 метастатичних уражень сальника (US Biomax).

AXL імуногістохімія. З парафинированних тканин були зроблені зрізи, які депарафинировались в ксилолі, регидратировались і демаскировались наступними стандартними иммуногистохимическими способами. Первинне антитіло AXL (RandD Systems) було використано в розведенні 1:500. Негативний контроль для всіх зразків був виконаний за допомогою тільки вторинних антитіл. Комплексний е�сидази (Vector Laboratories) згідно з протоколами виробника. Зрізи були контрастно пофарбовані гематоксилином. AXL фарбування на мембрані клітин пухлини оцінювали мікроскопічно у відповідності з відсотком позитивних клітин для AXL експресії (0 при відсутності, 1 для поганих щодо якості зразків, 2 для 5-60% і 3 для 61-100%).

Аналізи з репортером. Репортерная плазміда ММР-2 під контролем промотору ММР-2 в 1659п.про. була отримана в подарунок. Активність люциферази визначалася за допомогою Dual-Glo Luciferase Assay reagent (Promega) в shSCRM і shAXL SKOV3ip.1 клітинах, і вимірювалася в Monolight 2010 люминометре (Лабораторія аналітичної люмінесценції). Активність люциферази світлячка нормалізувалася до активності Renilla. Аналізи проводилися в трьох примірниках і були повторені двічі.

Тимчасові і ретровірусних трансфекції. Тимчасові трансфекції DMA проводилися липофектамином 2000 (Invitrogen) у відповідності з інструкціями виробника. 0,1 мкг ММР-2 кДНК (OpenBiosystems) був трансфецирован в 6 чашках.

мірнк (малі інтерферуючі РНК): мірнк послідовності, націлені на AXL або контроль, були придбані від Dharmacon. Всі мірнк трансфекції проводилися з використанням Dharmacon Smart Pools з Dharmafect 1 реагентом трансфекції згідно з протоколом виробника (Dharmacon, Lafayette, CO).

мшРНК: Олигонуклеотиди для специфиamble) була використана в якості контрольної МшРНК 5'-AATTGTACTACACAAAAGTAC-3'. Ці олигонуклеотиди були клоновані в RNAi-Ready pSiren RetroQ (BD Bioscience) вектори і SKOV3ip.1, MDA-231, і OVCAR-8 клітини через ретровирусную трансдукцию цих векторів. Інфіковані клітини були відібрані в пуромицин (Sigma), і поліклональні популяції були протестовані на зниження рівня експресії AXL Вестерн-блот аналізом.

Плазміди. Эктодомени AXL, відповідні амінокислот 1-451, були амплифицировани з кДНК людської AXL (Open Biosystems) і клоновані у CMV-керований pADD2 аденовірусний човниковий вектор. Тимчасові трансфекції ДНК з контрольним вектором або AXL 1-451 проводилися липофектамином 2000 (Invitrogen) згідно з інструкцією виробника в НСТ116 клітинах. Кондиціонована середовище була зібрана через 48-72 годин після трансфекції.

Аналізи адгезії. SKOV3ip.1 shSCRM і shAXL клітини флуоресцентно мечени Sum CMFDA (Molecular Probes). Клітини промивали і відокремлювали за допомогою неферментативного буфера клітинної дисоціації (Gibco). Клітини (5Х1Ое5) висівали в 96 клітинках, попередньо покритих з 50 мкг/мкл колагену типу I (BD Bioscience). Після 60-хвилинної інкубації при 37°С, клітини ретельно промивали 5 разів. Флуоресцентна активність (збудження, 494 нм, емісія, 517 нм) була виміряна за допомогою флуоресцентного спектрофотометра.

SKOV3ip.1 Адгезія до Коллщью неферментативного буфера клітинної дисоціації (Gibco). Клітини (5Х1Ое5) поміщали у трьох примірниках 96 клітинках планшета, які попередньо покриті з 50 мкг/мкл колагену типу I (BD Bioscience). Після 60-хвилинної інкубації при 37°С, клітини ретельно промивали 5 разів. Флуоресцентна активність (збудження, 494 нм, емісія, 517 нм) була виміряна за допомогою флуоресцентного спектрофотометра.

MDA-231 Адгезія до ЄСМ білків. MDA-231 shSCRM і shAXL (0.5×106) клітини поміщали в трьох примірниках у лунки, які містять панель білків ЄСМ, включаючи ламінін, колаген I і IV, фібронектин та фібриноген. Клітини інкубували при 37°С протягом 1 години і промивали в PBS. Пов'язані клітини фарбували і кількісно визначали на OD 560 згідно з протоколом виробника (CellBiolabs).

Аналізи міграції. Клітинна міграція була досліджена in vitro, як описано вище. Коротше кажучи, клітини були позбавлені сироватки протягом 24 годин і посіяні (2,5×104клітин) у трьох примірниках на непокриті вставки (BD Biosciences), перенесені в камеру, що містить FBS, як хемоаттрактант, і інкубовані протягом 24 годин. Після видалення клітин, які не проникли через мембрану клітини в нижній частині мембрани були зафіксовані, пофарбовані і підраховані. П'ять полів вважалися для кожної мембрани. Відсоток міграції визначали слід� в shSCRM клітинах) Х 100. Експерименти проводилися в трьох примірниках і повторювалися три рази.

Аналіз інвазії в колаген. Аналізи інвазії в колаген були проведені, як описано вище. Коротко, 533 клітини висівали на колаген типу I на 48-лунковому планшеті. Клітини культивували у стандартному середовищі або в середовищі з додаванням умовного контролю, або sAXL кондиціонованому середовищі протягом 5-7 днів і були зроблені фотографії. Інвазія через колаген кількісно розраховувалася шляхом визначення відсотка пухлинних клітин, які показують фенотип розгалуження в 20х полі. Три поля в зразку були підраховані. Експерименти проводилися в трьох примірниках і повторювалися 2 рази.

Зимография на желатиновом субстраті. SKOV3ip.1 shSCRM і shAXL клітини піддавали сироваткового голодування протягом 48 годин. 25000 клітин висівали в 96 осередках і кондиціонована середовище була зібрана через 24 години. Рівні об'єми кондиціонованому середовища помістили при не відновлюють умовах на 10% зимограммний гель (Invitrogen). Після електрофорезу гель промивали в 2,5% (об'єм/об'єм) Тритон Х-100 для видалення SDS і промивали в 50 мМ Трис-HCl, 5 мМ CaCI2і 0,1% Тритон Х-100 (рН 7,8), та інкубували протягом ночі при температурі 37°С. Зимограмми фарбували протягом 30 хвилин з 0,25% (�я в 40% метанолу і 10% крижаної оцтової кислоти. Експерименти проводилися у двох примірниках і повторювалися три рази.

Тести клітинної проліферації. Для одношарових кривих росту клітини (50000) висівали у 60 мм чашки в трьох примірниках. Кожні три дні клітини обробляли трипсином, підраховували за допомогою клітинного лічильника Коултера і 50000 клітин знову висівали і підраховували.

Аналіз виживання ХТТ. Життєздатність клітин вимірюється ХТТ аналізом, як описано вище. Коротше кажучи, культивовані з або без підживлення клітини (0, 3, 6 і 7 днів) інкубували з феноловим червоним в середовищі за вибором з 0,3 мг/мл ХТТ та 2,65 мкг/мл N-метилдибензопиразинметил сульфатом. 96-лункові планшети були повернуті в інкубатор при 37°С на час від 1 до 2 годин. Метаболізм ХТТ був кількісно виміряний по адсорбції при 450 їм.

Виділення білка та Вестерн-блот аналіз. Білки лізатів були зібрані в 9 М сечовині, 0,075 М Трис буфером (рН 7,6). Білки лізатів кількісно визначали, використовуючи аналіз за Бредфорд, і проводили SDS-PAGE у відновлювальних умовах за стандартною методикою. Отримані блоти були досліджені з антитілами проти AXL (RandD Systems), альфа-тубуліну (Fitzgerald Antibodies), AKT (Cell Signaling), фосфорна,-AKT (Cell Signaling).

Для GAS6 стимуляції клітини культивували у бессивороточной середовищі �ї середовищі, містить AXL эктодомени за 4 години до лікування з 400 нг/мл GAS6 протягом 15 хвилин.

Для аналізу sAXL експресії в сироватці мишей, 1,5 I сироватки від кожного зразка було проаналізовано за допомогою гель-електрофорезу.

Створення і виробництво аденовірусу. Эктодомен AXL відповідний амінокислот 1-451 був амплифицирован з кДНК AXL (Open Biosystems) та клоновано в області Е1 з Е1 "Е3" Ad штаму 5 шляхом гомологічної рекомбінації з наступною продукцією аденовірусу 293 клітинах і очищенням в градієнті CsCI, як описано раніше. Виробництво та очищення sAXL аденовірусу проводили, як описано вище. Створення і виробництво негативного контролю вірусу, экспрессирующего мишачий IgG2-Fc фрагмент імуноглобуліну, було описано вище.

Зростання SKOV3ip.1 і OVCAR-8 клітин, як перитонеальних ксенотрансплантатов. Всі процедури, пов'язані з тваринами і доглядом за ними, були затверджені Комітетом з догляду за тваринами та їх використання Стенфордського університету у відповідності з інституційними та NIH принципами.

Контроль і AXL SKOV3ip.1 і OVCAR-8 клітини вводили інтраперитонеально, 1×106і 5×106клітин, відповідно, в 0,5 мл PBS голих мишей жіночої статі. Після скарифікації асцит був кількісно визначено, метастатичес

Батьківські клітини SKOV3ip.1 і OVCAR-8 вводили інтраперитонеально, 1×106і 5×106клітин, відповідно, в 0,5 мл PBS голих мишей жіночої статі. Через сім (SKOV3ip.1) або 14 (OVCAR-8) днів після ін'єкції пухлинних клітин мишам вводили sAXL або контроль 1,9×108аденовірусних БОЮ в 0,1 мл PBS у хвостову вену. Після скарифікації асцит був кількісно визначено, метастатичні поразки були підраховані і всі видимі пошкодження були знайдені та вилучені для визначення ваги пухлини.

Вивчення тканинної токсичності. Батьківські клітини SKOV3ip.1 вводили інтраперитонеально, 1×106і 5×106клітин, відповідно, в 0,5 мл PBS голих мишей жіночої статі. Через сім днів після ін'єкції пухлинних клітин мишам вводили sAXL або контроль 1,9×108аденовірусних БОЮ в 0,1 мл PBS у хвостову вену. На 28-й день мишей скарифицировали. Кров була зібрана, і на кафедрі порівняльної медицини Стенфордського університету був проведений біохімічний аналіз крові та СВС аналіз. Зразки тканин були зібрані з усіх основних органів, включаючи печінку, нирки, мозок, селезінку, які фіксували в 10% формаліні, заливали в парафін, робили зрізи, і контрастно фарбували гематоксилином та еозином.

In vivo аналіз метастлой миші. Через чотири тижні після ін'єкції мишей скарифицировали. Мікроскопічна оцінка вогнищ в легенях проводилося за репрезентативною поперечних перерізів (зрізів) легких зафіксованим у формаліні і парафинированним, які фарбували гематоксилином та еозином. Правильна ідентифікація вогнищ в легенях з не менш чотирма людськими клітинами з великими ядрами і позитивними для експресії AXL була підтверджена сертифікованим патологоанатомом. Пухлинна навантаження в легенях мишей кількісно визначалась аналізом експресії людського GAPDH і AXL, оцінювалася шляхом аналізу РНК, виділеної з цілого легені, з допомогою ПЛР у реальному часі.

Зростання MDA-231 клітин як ортотопічній пухлини. MDA-231 клітини були вирощені, як підшкірні ортотопические пухлини в шеститижневих голих (nu/nu) мишах при підшкірних ін'єкціях 107клітин в 0,1 мл PBS в жирову тканину. Пухлини були виміряні штангенциркулем на 38-денному курсі. Обсяг був розрахований за наступною формулою: ширина2× довжина × 0.5.

Зростання SKOV3ip.1 клітин, як підшкірної пухлини. П'ять мільйонів клітин в 0,1 мл PBS були імплантовані підшкірно в боки голих (nu/nu) шеститижневих самок мишей. Пухлини вимірювали штангенциркулем на прот�ьном часу. РНК виділяли з клітин та тканин з використанням тризола за протоколами виробника (Invitrogen). кДНК синтезували з 2 мкг РНК, обробленої ДНКазой (Invitrogen), з використанням Superscript first-strand synthesis system для зворотної транскрипції-ПЛР (Invitrogen). Один мкл кДНК піддавали ампліфікації з використанням SYBR Green PCR Master Mix (Applied Biosystems). Такі набори праймерів були використані для ампліфікації конкретних цільових генів: 18S FWD: 5-GCCCGAAGCGTTTACTTTGA-3 REV:5-TCCATTATTCCTAGCTGCGGTATC-3; AXL FWD: 5-GTGGGCAACCCAGGGAATATC-3 REV: 5-GTACTGTCCCGTGTCGGAAAG; GAPDH 5-ATGGGGAAGGTGAAGGTCG-3 REV: 5-GGGGTCATTGATGGCAACAATA-3, ММР-2 FWD: 5 GCCCCAGACAGGTGATCTTG-3 REV 5 - GCTTGCGAGGGAAGAAGTTGT-3. ПЛР ампліфікацію проводили на Prism 7900 Sequence Detection System (Applied Biosystems). Використовувалися наступні параметри циклу: денатурація при 50°С протягом 2 хвилин і при 95°С протягом 10 хвилин, після чого цикл денатурації при 95°С протягом 15 с і при 60°С протягом 1 хвилини. 18S була використана як стандарт мРНК. Відносний рівень експресії мРНК визначали з допомогою способу відносної стандартної кривої у відповідності з інструкцією заводу-виробника (Applied Biosystems).

Статистичний аналіз. Тести для зв'язку між AXL експресією і формуванням і метастазуванням пухлини проводили з використанням точного критерію Фішера. Всі інші статистичні тести �ральних.

Скорочення: GAS6 - затримка росту специфічного гена 6, ММР-2 - матріксні металопротеїнази; ЕОС - епітеліальний рак яєчників; ЄСМ - позаклітинний матрикс; AKT - V-акт гомолог вірусного онкогена мишачої тимоми.

Таблиця 1
Статистичний аналіз AXL фарбування для оцінки параметрів пухлини
Оцінка0123Всього
Молочна залоза
Инфильтрующая карцинома проток
Стадія 13(75)0(0)0(0)1(25)4
5(38)13
Стадія 30(0)0(0)7(39)11(61)18
Разом60121735
Пірсона Х2 значення Р = Метастатична инфильтрующая карцинома проток Лімфатичних вузлів0(0)1(11)4(44)4(44)9
Яєчники
Серозна аденокарцинома
Стадія II3(33)0(0)3(33)5(8)14(22)39(61)64
Разом95174273
Пірсона Х2 значення Р = Метастатична серозна аденокарцинома Сальник3(9)5(16)6(19)18(56)32
Очеревина1(3)2(7)12(40)15(50)30
Разом47183362

Значення представлені як n (%). Для пухлинних клітин мембранні фарбування оцінювали як 0 - відсутні; 1 - неможливо підрахувати; 2 - від 5 до 60% позитивні; 3 - від 61 до 100% позитивні.

Приклад 2

Ми показали, що інгібування зв'язування GAS6 ліганду з клітинним AXL шляхом гіперекспресії р�лівої навантаження, оцінка якої проводилася шляхом вимірювання кількості і розмірів пухлини, порівняно з необробленим контролем, додатково підкреслюючи важливість GAS6 і AXL, як критичних цілей та ефективних стратегій для придушення прогресування метастазування в доклінічних мишачих моделях.

Розроблені розчинні варіанти позаклітинного домену AXL, як зазначено в цьому документі, які мають високу спорідненість до лігандами GAS6, дозволяючи їм поглинати ліганд і зменшити ендогенну AXL сигналізацію. Розроблені варіанти істотно поліпшили спорідненість до GAS6 порівняно з диким типом AXL.

Позаклітинний домен AXL складається з двох IgG-подібних доменів і двох фібронектин-подібних доменів. Основний сайт зв'язування GAS6 знаходиться в домені Ig1, і мінорний GAS6 сайт зв'язування знаходиться в Ig2 області.

В цілях подальшого підвищення спорідненості основного сайту зв'язування, ми спроектували Ig1 домен з точками розриву відповідних положень 19-132 в AXL SwissProt P30530. Мутантна бібліотека була створена шляхом виконання ПЛР-ампліфікації зниженою точності Ig1 домен рецептора AXL з використанням стандартних методів молекулярної біології. Бібліотека експресується з допомогою поверхневого дисплея на дро, �бладающие поліпшеним спорідненістю зв'язування з розчинним GAS6. У нашому підході скринінгу бібліотеки, бібліотека мутантного білка була піддана кількох раундів сортування, в яких кожний наступний раунд зменшує розмір бібліотеки, в той час як вона одночасно збагачується за змістом мутантних білків з бажаною властивістю, в даному випадку це високу спорідненість до зв'язування з GAS6.

Для того щоб отримати мутанти AXL зі значно більшою спорідненістю до GAS6, в більш пізніх раундах сортування використовували сортування по швидкості дисоціації. Для сортування по швидкості дисоціації бібліотеку мутантів білка спочатку інкубують з розчинними GAS6, а потім промивають буфером для видалення незв'язаних GAS6 з розчину. Далі, мутантную бібліотеку інкубували в присутності надлишку розчинної конкурента протягом 2, 4, 6, 12 або 24 години при кімнатній температурі. Надлишок конкурента служить для уловлювання GAS6, який відділяється від AXL знаходиться на поверхні дріжджів, що робить крок відділення незворотнім. Мутантні AXL білки, які зберігають зв'язування з GAS6, збираються з використанням FACS. Аналіз зв'язування з GAS6 на об'єднаній вибірці 5 продуктів після диссоциирующих кроків через 0,�иях стійкого зв'язування з GAS6 (див. фігуру 12). Гістограма кількісних даних з точковими ділянками демонструє значне поліпшення членів бібліотеки. Секвенування цих продуктів виявило кілька мутацій в домені Axl Ig1, які надають посилене спорідненість до GAS6, спостережуване для об'єднаного пулу 5 продуктів (фігура 12 і таблиця 2). Шостий раунд сортування дає подальше збагачення до 3 конкретних клонів з виділених 5 продуктів. Таблиця 2 показує унікальні мутації амінокислот в послідовності AXL, які містяться в цих продуктах 5 і 6 раундів. У цій таблиці номер залишку у верхньому рядку відповідає амінокислотним залишком в AXL дикого типу. У другому рядку зазначається залишок, який знаходиться в AXL дикого типу на даній позиції. У наступних рядках вказані амінокислотні мутації, присутні в даному мутант. Відсутність амінокислоти для конкретного залишку в мутанта (наприклад, пробіл або порожня клітинка в таблиці 2) означає, що цей амінокислотний залишок не мутував в дикий тип залишку. Стандартне однобуквенное позначення амінокислотних залишків використовується, так як його добре розуміють ті, хто є фахівцем у цій галузі.

Показані унікальні последовательностидемонстрирующие істотне поліпшення зв'язування з GAS6 для об'єднаної вибірки 5 продуктів.

Мутанти, ізольовані за допомогою цього підходу спрямованої еволюції, що включає амінокислотні заміни, наведені в таблиці 3.

Таблиця 3
Мутанти, виділені з використанням спрямованої еволюції
26323374798792127
Wt-AXLЕGNSVDVG
Axl S6-1SGAR
Axl S6-2GAE
Axl S6-5SNGA

У відповідності з кристалічною структурою комплексу GAS6-AXL, як повідомив Sasaki et al. (EMBO J 2006), всі мутації, які були показані вище, за винятком E26G, G32S, N33S і G127R/E, знаходяться на поверхні зв'язування між AXL та GAS6.

Індивідуальні мутанти AXL S6-1 і AXL S6-2, починаючи з шостого раунду сортування, були відібрані для подальшого дослідження. Вивчення рівноважного зв'язування дикого типу AXL, AXL S6-1 і AXL S6-2 були проведені для порівняння спорідненості взаємодії з GAS6 у дикого типу або мутантних білків AXL. Дані лягли на четирехточечную сигмоидальную криву, і середня точка була взята в якості рівноважної константи зв'язування, KD. Мутанти AXL S6-1 і AXL S6-2 показують значне поліпшення спорідненості зв'язування з GAS6 порівняно з диким типом AXL (фігура 13 таблиця 4). Дикий тип AXL має спорідненість до зв'язування (KD) з GAS6 2,4±1,2×10-9М; AXL S6-2 має спорідненість до зв'язування (KD6-2 це в 22 рази і 12,8 рази сильніше GAS6 спорідненості зв'язування, відповідно, у порівнянні з диким типом AXL (таблиця 4).

Таблиця 4
Спорідненість зв'язування (KD) дикого типу та мутантних білків AXL з GAS6
Рівновага GAS6 зв'язування
KD(М)+/- (М)Перевищення над wt
wt AXL2,4×10-91,2×10-9-----
S6-11,12×10-100,23×10-1022
S6-21,89×10-100,37×10-1012,8

Ми також досліджували термостабільність дикого типу та мутантних білків AXL з використанням сканування кругового дихроїзма при змінній температурі. Цей спосіб відстежує розгортання вторинних структурних елементів згорнутого білка в залежності від тестандартной двузонной кривий розгортання. Температура плавлення (Tm) є серединної точки кривої розгортання. Для дикого типу AXL виставлена температура плавлення 41,3±0,6°С; для AXL S6-1 виставлена температура плавлення 54,0±0,9°С (приблизно на 13°С вище термічна стабільність, ніж у дикого типу AXL); для Axl S6-2 виставлена температура плавлення 41,55±0,02°С (приблизно однакова термічна стабільність з диким типом AXL) (таблиця 5).

Таблиця 5
Термічна стабільність дикого типу та мутантних білків AXL, як визначено по скануванню кругового дихроїзма при змінній температурі
Середня Tm(°С)+/- (°С)Збільшення порівняно з wt (°C)
wt AXL41,270,63-----
S6-154,010,8612,73
S6-241,550,02GAS6-AXL сигналізація була залучена до прогресування багатьох агресивних форм солідних пухлин, у тому числі молочної залози, легенів і товстої кишки, і, як було виявлено в даній роботі яєчників. В той час, як чітка кореляція спостерігається між експресією AXL і стадією захворювання, а також прогноз для пацієнта, можливість використання AXL в якості терапевтичної мішені для лікування метастазування практично не досліджена. У прикладі 1 показано, що AXL дійсно є маркером метастазування у хворих на рак молочної залози та яєчників, рівні експресії AXL на первинних пухлинах корелюють з тяжкістю захворювання. Ці результати свідчать про те, що антагонізм сигнального шляху GAS6-AXL може запропонувати терапевтичне вікно для лікування метастатичного захворювання. Як зазначено в прикладі 1, для перевірки потенціалу AXL, як терапевтичної мішені, розчинну форму дикого типу позаклітинного домену AXL вводили з використанням аденовірусної доставки в мишачої моделі агресивного раку яєчників. Ми показали, що пухлинні метастази були значно зменшені у мишей, які отримали лікування розчинним AXL порівняно з контрольною групою. Ці дані покатическому прогресування захворювання. Грунтуючись на цих результатах, ми показали, що інженерні мутанти AXL з більш високою спорідненістю до GAS6 проявляють більшу ефективність як антиметастатические агенти, і що більш відповідний терапевтичний режим доставки розчинних AXL дає ще більш значні результати.

У цьому дослідженні ми використовували ті ж моделі людського раку яєчників, як і в експерименті 1 і варіанти интраперитонеального введення очищеного розчинної AXL (sAXL) мишам з існуючою метастатичною хворобою. Ми перевірили AXL дикого типу та інженерно створений мутант AXL S6-1, з високою спорідненістю, порівняно з однією з форм AXL, E59R/T77R, який не зв'язується з GAS6. Наші результати наочно показують, що збільшене спорідненості AXL S6-1 призводить до більшої терапевтичної ефективності, так як було значне зниження пухлинної навантаження, яке оцінюється по кількості та вазі всіх метастатичних уражень, порівняно з AXL дикого типу і негативним контролем AXL E59R/T77R. Ці дані далі перевірені на AXL та GAS6, як терапевтичних мішенях для інгібування метастазування, і підтверджують, що сконструйований мутант S6-1 з високою спорідненістю до AXL є потужним антагоністом сигнальної системи Gь, цей спосіб доставки не має клінічного значення і, таким чином, ми підтвердили, що доставка очищеної sAXL дасть аналогічні результати. Дикого типу AXL, AXL S6-1 і AXL E59R/T77R були об'єднані під фрагмент кристаллизующейся області (Fc) мишачого IgG2a в цілях поліпшення фармакокінетики. Єдина відмінність між цими варіантами потрійний AXL гібридизації (AXL-FC) полягає у виявлені мутації в AXL Ig1 домені, які наведені в таблиці 6А. ДНК кодовані AXL-Fc білки клонували в аденовірусної шаттл-вектор pADD2c під контролем CMV з використанням EcoRI і Sall сайтів рестрикції. pADD2 плазміда, що кодує ці три AXL мутанта, була незалежно трансфецирована в HEK 293 клітини з використанням набору Freestyle Expression kit від Life Technologies, як описано виробником. Білки були очищені від культури супернатанту з використання Protein А афінної хроматографії, а потім за розміром з використанням ексклюзивної хроматографії.

Таблиця 6
Найменування білкаОпис
Дикого типу AXL-FcДикого типу AXL позаклітинний домен, амінокислоти 1XL-Fc, як зазначено вище для дикого типу AXL-Fc, однак AXL Ig1 домен містить такі мутації для S6-1: G32S, D87G, V92A, G127R.
AXL E59R/T77R-FCЗлиття AXL-Fc, як зазначено вище для дикого типу AXL-Fc, проте домен Axl Ig1 містить E59R і T77R мутації, які значно зменшують зв'язування з GAS6.

Щоб оцінити здатність AXL-Fc мутантів до пригнічення метастазування in vivo, ми використовували ту ж модель перитонеального ксенотрансплантата людського раку яєчників, як описано в прикладі 1. Ця модель повторює перитонеальне поширення метастазів людського раку яєчників, так як у миші швидко розвивається дуже інвазивне захворювання, що включає асцит і багато (>100) невеликих метастатичних уражень, чотири тижні після введення SKOV3ip.1 клітин. Ця модель дає дуже точне уявлення про людському раку яєчника, оскільки більшість пацієнтів має значні метастази на момент встановлення діагнозу. Мишам вводили SKOV3ip.1 клітини пухлини було дозволено диссеминировать (метастази) протягом семи днів. На сьомий день ми випадковим чином розділили мишей на три досліджувані групи і почали вступне лікування або AXL-Fc дикого типу, S6-1-Fc або E59Rчение трьох тижнів в дозі 10 мг/кг, у загальній складності шість доз. На двадцять восьмий день всі миші були скарифицировани, і розтин було проведено для оцінки загальної пухлинної навантаження по вимірюванню кількості видимих метастазів, а також вазі всіх поразок. Існували глибокі відмінності між групами лікування, чиї репрезентативні зображення показано на фігурі 14. На мишей, які отримували лікування негативним контролем E59R/T77R-Fc, доводилося в середньому 86,3±21,9 перитонеальних метастазів. Для мишей, що отримували дикого типу AXL-Fc, це число скоротилося до 48,1±6,9, а для мишей в інженерній AXL групі, S6-1-Fc, тільки 8,3±1,6 метастатичного ураження спостерігалося в середньому (фігура 15 (верхня панель)). Всі видимі пошкодження були вирізані і колективно зважені для кожної миші для оцінки загальної маси метастатичної пухлини. Лікування групи інженерним AXL (S6-1-Fc) знову показало найглибший відгук, так E59R/T77R-Fc, дикого типу Fc і S6-1-Fc групах певна маса пухлини склала 567±92,430±36 і 188±55 мг відповідно, на фігурі 15 (нижня панель).

У сукупності ці результати в подальшому перевірили AXL, як терапевтичну мішень при лікуванні метастазування, і продемонстрували, що нейтралізація лігандів AXL, GAS6 є ефективною антимет�уживаемое зв'язування з GAS6 (AXL E59R/T77R-Fc), не перешкоджає метастазуванню пухлини; білок, що включає гібрид AXL-Fc, який зв'язується з GAS6 з помірним спорідненістю (дикий тип AXL-FC), показує невелике гальмування метастазування пухлини; білок, що включає гібрид AXL-Fc, з дуже великим спорідненістю до GAS6 (AXL S6-1-Fc), показує значне пригнічення метастазування пухлини. Все разом це показує, що епітоп взаємодії GAS6 і AXL має вирішальне значення в пухлинному метастазуванні і потужний інгібітор цього епітопи на GAS6 через AXL S6-1-Fc білок значно інгібує метастазування пухлин. Таким чином, AXL S6-1-Fc білок або білок, який потужно блокує GAS6-Axl взаємодії, є перспективним терапевтичним кандидатом для метастатичної хвороби. Крім того, ми також показали, що пряме введення очищеного розчинного білка AXL є успішним способом лікування, перевіривши цей підхід клінічно.

Способи для прикладу 3

Клітинні лінії. Клітини яєчників SKOV3ip.1 культивували у відповідній середовищі з додаванням 10% ембріональної телячої сироватки та 1% пеніциліну і стрептоміцину при 37°С у 5% CO2інкубаторі.

AXL-Fc гібридизація. Повнорозмірні AXL мутанти, амінокислоти 19-440 безпосередньо злитий з областю мишачого Іх клітин людських нирок (HEK) 293 здійснювали за допомогою набору Freestyle Expression kit від Life Technologies, як зазначено виробником. Fc-гібридні білки очищали з культури супернатанту через п'ять днів з допомогою Protein А афінної хроматографії і розмір ексклюзивної хроматографії (гель-фільтрації). Очищені білки були поміщені в фосфатний буферний сольовий розчин без додаткових добавок або носіїв.

SKOV3ip.1 перитонеальні ксенографи. Всі процедури, пов'язані з тваринами та доглядом за ними були затверджені Комітетом з догляду за тваринами та їх використання Стенфордського університету у відповідності з інституційними та NIH принципами. Шестинедельним самкам голих мишей вводили 1×106SKOV3ip.1 клітин інтраперитонеально. Сім днів після введення клітин, миші були випадковим чином розділені на три групи лікування: S6-1-Fc, дикого типу AXL-Fc або E59R/T77R-Fc. Очищений розчинний білок AXL-Fc вводили за допомогою ін'єкції інтраперитонеально два рази на тиждень у дозі 10 мг/кг Дозування тривало протягом трьох тижнів, після чого миші були скарифицировани. Розтин було проведено, в якому метастатичні ураження були підраховані, а потім вирізані і колективно зважені. Пухлинна навантаження визначалася, як загальне число поразок і загальна вага всіх хворих тканин для кожної миші.

З�ками середнього (SEM). Значення p зі значенням <0,01 вважали значущими.

Хоча вище винахід було описано більш докладно з допомогою ілюстрацій та прикладів для ясності розуміння, але це буде очевидно для будь-якого фахівця в цій області в світлі вчення цього винаходу, що деякі зміни і модифікації можуть бути зроблені до нього без відступу від духа або обсягу додається формули винаходу.

1. Розчинний варіант поліпептиду AXL, де поліпептид не має трансмембранного домену AXL і містить щонайменше одну модифікацію амінокислоти в порівнянні з послідовністю AXL дикого типу (SEQ ID NO: 1), в якому зазначена модифікація підвищує спорідненість зв'язування поліпептиду AXL зі специфічно затримує зростання білком 6 (GAS6), яка щонайменше приблизно в 2 рази сильніше, ніж спорідненість поліпептиду AXL дикого типу,
де зазначена модифікація знаходиться в положенні номер n, де n обраний 32, 72, 87, 92 або 127 або їх поєднання, де n+7 відповідає нумерації SEQ ID NO: 1;
де розчинний варіант поліпептиду AXL інгібує взаємодію між AXL і GAS 6.

2. Розчинний варіант поліпептиду AXL за п. 1, який відрізняється тим, що варіант AXL включає в себе заміну амінокислоти в порівнянні з послідовністю AXL дикого Ѳариант AXL включає в себе заміну амінокислоти в порівнянні з послідовністю AXL дикого типу по наступних позиціях: а) гліцин 32; (b) аланін 72; (з) аспарагінова кислота 87; (d) валін 92 і (у) гліцин 127.

3. Розчинний варіант поліпептиду AXL, де поліпептид не має трансмембранного домену AXLи містить щонайменше одну модифікацію амінокислоти в порівнянні з послідовністю AXL дикого типу (SEQ ID NO: 1), в якому зазначена модифікація підвищує спорідненість зв'язування поліпептиду AXL зі специфічно затримує зростання білком 6 (GAS6), яка щонайменше приблизно в 2 рази сильніше, ніж спорідненість поліпептиду AXL дикого типу, який відрізняється тим, що варіант AXL включає в себе низку амінокислотних замін, порівняно з послідовністю AXL дикого типу (SEQ ID NO: 1), вибрані з наступних груп: (1) Gly32Ser, Asp87Gly, Val92Ala і Gly127Arg; (2) Glu26Gly, Val79Met, Val92Ala і Gly127Glu; (3) Asn33Ser, Ser74Asn, Asp87Gly і Val92Ala; (4) Ala72Val, Ile97Arg і His116Arg; (5) Gln78Glu; (6) Ala72Val; (7) Gln86Arg, Ile90Val і Val92Ala; (8) Ala72Val і Val92Asp; (9) Asp65Asn і Asp87Gly; (10) Asp87Gly і Val92Ala; (11) Glu27Lys, His61Tyr, Ala72Val, Asp88Asn, Val92Ala і Thr98Ala; (12) Val92Ala і Gln109Arg; (13) Thr44Ala, Ala72Val, Ile90Val, Thr105Met і Glu129Lys; (14) Val92Gly; (15)Val92Ala, Val112Ala, Phe113Leu і Thr118Ala; (16) Val92Ala, Thr98Pro; (17) Glu27Gly і Asp87Gly; (18) Thr38Ile і Val92Ala; (19) Asp87Gly; (20) Thr23Met і Val92Ala; (21) Ala72Val і Phe113Leu; (22) Gln86Arg і Val92Ala; (23) Ala19Thr, Glu26Gly, Glu27Gly і Val92Ala; (24) Ile90Met і Val92Ala; (25) Gly32Ser і Asp87Gly; (26) Gly32Ser і Val92Ala; (27) Gly32Ser і Glyl27Arg; (28) Asp87Gly і Gly127Arg; (29) Val92Ala і Gly127Arg; (30) Asp87Gly, Val92Ala і Gly127Arg; (31) Gly32Ser, Val92Ala і Gly127Arg; (32)знаходиться в положенні номер n, де n+7 відповідає нумерації SEQ ID NO: 1,
де розчинний варіант поліпептиду AXL інгібує взаємодію між AXL та GAS6.

4. Гібридний білок, що містить Fc домен і розчинна варіант поліпептиду AXL,
де зазначений варіант AXL не має трансмембранного домену AXL і містить щонайменше одну модифікацію амінокислоти в порівнянні з послідовністю AXL дикого типу (SEQ ID NO: 1), в якому зазначена модифікація підвищує спорідненість зв'язування поліпептиду AXL зі специфічно затримує зростання білком 6 (GAS6), яка щонайменше приблизно в 2 рази сильніше, ніж спорідненість поліпептиду AXL дикого типу,
де зазначена модифікація знаходиться в положенні номер n, де n обраний 32, 72, 87, 92, 97 або 127, або їх поєднання, де n+7 відповідає нумерації SEQ ID NO: 1;
де розчинний варіант поліпептиду AXL інгібує взаємодію між AXL і GAS 6.

5. Фармацевтична композиція для інгібування AXL/GAS6 шляхів, що містить терапевтично ефективна кількість одного або декількох варіантів розчинної поліпептиду AXL по кожному з пп. 1-3, або гібридного білка за п. 4, або його фармацевтично прийнятну сіль.

6. Фармацевтична композиція для інгібування AXL/GAS6 шляхів, що містить терапевтично ефективний ко по п. 4 і додатково містить ефективну дозу щонайменше одного цитотоксичної агента або фармацевтично прийнятний наповнювач, або їх комбінацію.

7. Застосування розчинної варіанти поліпептиду AXL по кожному з пп. 1-3, або гібридного білка за п. 4, або композиції з п. 5 або 6 в способі лікування, зниження або запобігання метастазування або інвазії пухлини у пацієнта, що відноситься до ссавців.

8. Застосування п. 7, відмінне тим, що пухлина обрана з пухлини, що входить в групу, що складається з пухлини яєчників, пухлини молочної залози, пухлини легень, пухлини печінки, пухлини товстої кишки, пухлини жовчного міхура, пухлини підшлункової залози, пухлини передміхурової залози, а також гліобластоми.



 

Схожі патенти:

Набір олігонуклеотидних праймерів і флуоресцентно-міченого зонда для ідентифікації burkholderia pseudomallei

Винахід відноситься до галузі біохімії, зокрема до набору олігонуклеотидних праймерів і флуоресцентно-міченого зонда для ідентифікації Burkholderia pseudomallei і диференціації від збудника сапу методом полімеразної ланцюгової реакції з флуоресцентною детекцією. Заявлений винахід дозволяє в короткий термін з високою чутливістю і специфічністю детектувати збудника меліоїдоза і диференціювати його від збудника сапу в пробах чистих культур та біологічному матеріалі. 1 іл., 1 табл., 3 пр.

Спосіб визначення генотипу людини з поліморфною позиції rs1613662 в гені gp6, кодує глікопротеїн vi

Винахід відноситься до галузі медицини, молекулярної біології та біотехнології. Запропоновано спосіб визначення поліморфізму гена GP6 людини, що кодує глікопротеїн VI, з поліморфною позиції rs 1613662, заснований на зняття кривих плавлення з флуоресцентно-міченими алель-специфічними олигонуклеотидними пробами. Завдяки збільшенню надійності визначення варіабельних позицій і можливості проводити визначення в одній пробірці на стандартному обладнанні спосіб може бути ефективно використаний для діагностики спадкових схильностей людини з реєстрацією результатів ПЛР в реальному часі. 1 іл.

Пептиди, які проникають у клітини, і їх застосування

Винахід відноситься до галузі біотехнології, конкретно до інтерналізації терапевтичних молекул всередину клітини, і може бути використане в медицині. Отримують композицію для доставки молекул нуклеїнових кислот в клітини, що містить щонайменше один пептид з щонайменше 92% ідентичністю до GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); або YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), приєднаний до однієї або кількох молекул нуклеїнових кислот. Винахід дозволяє підвищити ефективність доставки молекул нуклеїнових кислот всередину клітини ссавця за рахунок пептиду, здатного интернализироваться всередину клітини ссавця з ефективністю, що становить щонайменше 200% від ефективності інтерналізації пептиду ТАТ, має аминокислотную послідовність GRKKRRQRRRPPQ (SEQ ID NO: 1). 5 н. і 3 з.п. ф-ли, 16 іл., 1 табл., 8 пр.

Спосіб аналізу рнк

Винахід відноситься до біотехнології, а саме до способу аналізу придатності РНК, екстрагованої з тканини або клітини (клітин), фіксованих за допомогою фіксатора, для аналізу експресії генів. Спосіб включає проведення електрофорезу з зазначеної РНК. Визначають, чи відповідає зазначена РНК наступному рівнянню: В/А≤1, де А являє масове співвідношення (%) РНК в діапазоні від 1000 до 4000 нуклеотидів до загальної маси РНК, що визначено електрофорезом, а являє масове співвідношення (%) РНК в діапазоні більш ніж 4000 нуклеотидів до загальної маси РНК, що визначено електрофорезом. Якщо зазначена РНК, экстрагированная з тканини або клітини (клітин), що задовольняє вказаним рівнянню, то вона придатна для аналізу експресії генів. Запропоноване винахід дозволяє швидко і з високою ефективністю визначити придатність РНК для аналізу експресії генів. 6 з.п. ф-ли, 3 іл., 11 табл., 7 пр.

Виборчий лізис клітин

Група винаходів відноситься до області лізису клітин. Запропоновано спосіб виборчого лізису клітин тварин, а також прилад для виявлення мікроорганізмів. Спосіб виборчого лізису тварин клітин в пробі води з тваринами клітинами, що містить або, можливо, містить мікроорганізми, включає етапи забезпечення проби води з тваринами клітинами, що містить або, можливо, містить мікроорганізми, додавання в згадану пробу неіоногенної детергенту і буферного розчину для одержання розчину зі значенням pH близько 9,5 або вище, інкубації цього розчину протягом періоду, достатнього для лізису клітин тварин. Прилад для виявлення мікроорганізмів у пробі складається з лизисной камери для прийняття проби води з тваринами клітинами, посудини з лужним буферним розчином із значенням pH 9,5 або вище і неіоногенним детергентом, або посудини з лужним буферним розчином із значенням pH близько 9,5 або більше і посудини з неіоногенним детергентом, фільтра, сполученого з лизисной камерою для фільтрування проби після лізису клітин тварин, камери індикації для аналізу присутності ДНК мікроорганізмів. Запропоновані винаходу забезпечують обробку зразка без його значного брабативать більш значні обсяги зразка і визначати низькі концентрації хвороботворних мікроорганізмів у зразку. 2 н. і 11 з.п. ф-ли, 12 іл., 8 пр.

Спосіб диференціації токсигенних генетично змінених штамів vibrio cholerae біовару ель-тор з різним епідемічним потенціалом методом мультиплексного полімеразної ланцюгової реакції та тест-система для його здійснення

Винаходи належать до галузі медичної мікробіології і стосуються способу диференціації токсигенних генетично змінених штамів V. cholerae біовару Ель-Тор і тест-системи. Охарактеризований спосіб включає проведення ПЛР з використанням специфічних праймерів до генам vc0497, vc0502 і vc0514 з острова пандемичности VSP-II. Охарактеризована тест-система містить компоненти для виділення ДНК, компоненти для проведення ПЛР, що включають, зокрема, суміш праймерів VSPIIreg-F - 5'-TGGAAAGAAGAGCGTTACTGC-3', VSPIIreg-R - 5'-CCCTGTTGATGATGTGATTTG-3' ген vc0497, VSPIIpilin-F - 5'-CTGTGATTCGGGCTTTATCGG-3', VSPIIpilin-R - 5'-GCGTAAACTGAGCCAATAAGC-3' ген vc0502, VSPIIchem-F - 5'-CTTGATGGAGCGGAGAAAAC-3', VSPIIchem-R - 5'-CGATGAATAGCCTGTTGAAC-3' ген vc0514, взятих у співвідношенні 1:1:1:1:1:1 відповідно. Винаходи дозволяють швидко і достовірно диференціювати токсигенні генетично змінені штами V. cholerae біовару Ель-Тор на геноварианти з низьким і високим епідемічним потенціалом. 2 н. п. ф-ли, 1 іл., 2 табл.

Спосіб виявлення мутацій в гені myo7a, що супроводжуються розвитком несиндромальной аутосомно-рецесивною глухоти і синдромом ушера

Винахід відноситься до галузі біохімії, зокрема до способу виявлення мутацій в гені MYO7A, що супроводжуються розвитком несиндромальной аутосомно-рецесивною глухоти або синдром Ушера. Спосіб включає виділення ДНК з лімфоцитів периферичної крові методом фенольно-хлороформною екстракції, проведення ПЛР, ампліфікацію 18 ділянок гена MYO7A, детекцію в денатурирующем акриламидном гелі і секвенування. ПЛР проводять з використанням спеціально підібраних послідовностей олігонуклеотидів, фланкують області 18 екзонів гена MYO7A з можливим вмістом різних мутацій. Винахід дозволяє спростити спосіб і підвищити точність визначення мутацій гена MYO7A, а також скоротити час дослідження. 3 іл., 1 пр.
Винахід відноситься до галузі біотехнології і стосується специфічних олігонуклеотидних праймерів. Представлені праймери включають сайти эндонуклеазного розщеплення, фланкуючі ділянки геному, що кодують глікопротеїни Gn і Gc, а також нуклеопротеин N, для отримання бібліотеки генів, що кодують глікопротеїни Gn і Gc і нуклеопротеин N вірусу лихоманки долини Ріфт. Охарактеризованное винахід може бути використаний у створенні банку нуклеотидних послідовностей, що кодують імунодомінантні білки вірусу лихоманки долини Ріфт Gn, Gc і N, які можна використовувати при створенні діагностичних і вакцинних препаратів на основі рекомбінантних технологій. 3пр.

Олігонуклеотидні праймери і спосіб виявлення днк mycobacterium avium методом полімеразної ланцюгової реакції

Винаходи належать до галузі біотехнології і стосуються олігонуклеотидних праймерів і способи виявлення ДНК Mycobacterium avium з їх використанням. Охарактеризовані олігонуклеотидні праймери комплементарни специфічної області mig-гена Mycobacterium avium і мають наступний нуклеотидний склад: 5'-CGT CAA AAG CGA ACT GCA-3' та 5'-ТАА ТТС GTT GCC CGA СТС-3'. Спосіб виявлення ДНК Mycobacterium avium вимикає виділення ДНК, проведення ампліфікації ДНК з використанням олігонуклеотидних праймерів, перенесення продукту ампліфікації на гель з подальшим детектуванням результатів аналізу на трансиллюминаторе. У разі позитивної реакції синтезується фрагмент, відповідний розміру 157 п. н. Представлені винаходи можуть використовуватися у ветеринарних діагностичних і науково-практичних лабораторіях для виявлення генетичного матеріалу Mycobacterium avium у пробах. 2 н. п. ф-ли, 1 іл., 4 пр.

Набір синтетичних олігонуклеотидів для визначення нуклеотидної послідовності кодуючої частини генів nkx2.5, cfc1, gata4 і виявлення мутацій, асоційованих з орфанной моногенной патології, яка лежить в основі сімейних форм вроджених вад серця

Винахід відноситься до галузі кардіології і стосується набору синтетичних олигонуклотидов. Представлений набір використовується для виявлення мутацій кодуючої частини генів NKX2.5, CFC1, GATA4, асоційованих з орфанной моногенной патології, яка лежить в основі сімейних форм вроджених вад серця. Мутації виявляють шляхом визначення повної нуклеотидної послідовності кодуючої частини генів NKX2.5, CFC1, GATA4. Здійснюють ампліфікацію кодуючої частини генів NKX2.5, CFC1, GATA4 з допомогою 15 пар синтетичних олігонуклеотидів при одній температурі та часу відпалу з подальшим секвенированием отриманих продуктів ампліфікації за допомогою однієї пари універсальних праймерів. Запропоноване винахід дозволяє чутливо і специфічно визначати мутації генів NKX2.5, CFC1, GATA4, при цьому скорочуються час реакції ампліфікації, кількість маніпуляцій, час внесення реактивів для реакції секвенування і знижується ймовірність помилки при постановці реакції. 2 з.п. ф-ли, 1 іл., 4 табл.

Зв'язують протеїни, специфічні по відношенню до інсулін-подібним факторам зростання, і їх використання

Даний винахід відноситься до галузі імунології. Запропоновано повністю людське моноклональне антитіло, яке зв'язує інсуліноподібний фактор росту-II (IGF-II) і має перехресну реактивність IGF-I, а також його антигенсвязивающий фрагмент. Розглянуто молекула нуклеїнової кислоти, що кодує антитіло щодо винаходу, вектор і клітина-господар для експресії антитіла щодо винаходу. Описана фармацевтична композиція, а також кон'югати для лікування та діагностики злоякісної пухлини, застосування антитіла щодо винаходу в отриманні лікарського засобу та спосіб визначення рівня IGF-II і IGF-I в пробі пацієнта. Даний винахід може знайти подальше застосування в терапії раку. 8 н. і 8 з.п. ф-ли, 27 пр., 18 табл.

Антитіла проти фактора росту нервів (фрн), що володіють підвищеною стабільністю in vivo

Даний винахід відноситься до біотехнології і являє собою антитіла проти фактора росту нервів (ФРН). Справжній винахід також розкриває фармацевтичну композицію для полегшення болю, асоційованої з захворюванням або станом, при якому розвиток чи збереження болю опосередковано ФРН, що містить зазначені антитіла, а також набір для лікування пов'язаного з ФРН захворювання, такого як, наприклад, остеоартрит, нуклеїнові кислоти, що кодують важку або легку ланцюг антитіла, вектор експресії, що клітку-господаря для отримання зазначених антитіл, спосіб експресії зазначених антитіл проти ФРН, а також застосування зазначених антитіл в способі лікування болю і для одержання лікарського засобу для лікування болю, асоційованої з захворюванням або станом, при якому розвиток чи збереження болю опосередковано ФРН. Даний винахід дозволяє отримати антитіла проти ФРН, що характеризуються підвищеною стабільністю in vivo. 10 н. і 6 з.п. ф-ли, 7 іл., 13 табл., 8 пр.

Полиспецифические антитіла

Винахід відноситься до галузі біотехнології, конкретно до биспецифическим антитілам, і може бути використане в медицині. Конструюють антитіло, що містить одну з таких груп із шести послідовностей гипервариабельной області (HVR): (a) HVR-L1, що включає послідовність NIAKTISGY; (b) HVR-L2, що містить послідовність WGSFLY; (c) HVR-L3, містить послідовність HYSSPP; (d) HVR-H1, містить послідовність NIKDTY; (e) HVR-H2, що містить послідовність RIYPTNGYTR; та (f) HVR-Н3, містить послідовність WGGDGFYAMD; або (a) HVR-L1, що включає послідовність NIAKTISGY; (b) HVR-L2, що містить послідовність WGSFLY; (c) HVR-L3, містить послідовність HYSSPP; (d) HVR-H1, містить послідовність NISGTY; (e) HVR-H2, що містить послідовність RIYPSEGYTR; та (f) HVR-Н3, містить послідовність WVGVGFYAMD. Отримане антитіло специфічно зв'язує рецептор людського епідермального фактора росту 2 (HER2) і судинний ендотеліальний фактор росту (VEGF). Винахід відноситься також до виділеного фрагмента Fab зазначеного антитіла, полинуклеотиду, його кодирующему, вектора експресії, клітині-хазяїну, способу його одержання, а також до його застосування для лікування HER2-опосередкованих захворювань. Даний винахід дозволяє поЄ-ли, 65 іл., 16 табл., 8 пр.

Високоафінні людські антитіла до людського ангиопоэтину-2

Винахід відноситься до біотехнології. Запропоновано виділене людське антитіло або його антиген-зв'язуючий фрагмент, який специфічно зв'язується з людським ангиопоэтином-2 (hAng-2), але по суті не зв'язується з hAng-1, що характеризується наявністю CDR змінної галузі важкої та легкої ланцюга. Описана фармацевтична композиція на основі терапевтично ефективного кількості антитіла. Розкриті: варіанти застосування виділеного антитіла або його антиген-зв'язуючого фрагмента у виробництві лікарського засобу для застосування у лікуванні пацієнта, має різні захворювання, включаючи пухлину. Описані варіанти способу лікування різних захворювань. Використання винаходу забезпечує антитіло, високоспецифичное до людського ангиопоэтину-2 (hAng-2) з константою афінності близько 10-11, яке по суті не зв'язується з hAng-1, що може знайти застосування в лікуванні різних захворювань, пов'язаних з підвищеною активністю hAng-2. 6 н. і 13 з.п. ф-ли, 35 табл., 3 іл., 13 пр.

Биспецифические анти-vegf/анти-ang-2 антитіла

Винахід відноситься до галузі біотехнології та імунології. Описані биспецифические антитіла проти фактора росту судинного ендотелію людини VEGF і ангиопоэтина-2 людини ANG-2, способи їх отримання, фармацевтичні композиції, що містять зазначені антитіла, і їх застосування. 6 н. і 7 з.п. ф-ли, 26 іл., 15 табл., 19 пр.

Лікування розсіяного склерозу

Даний винахід відноситься до галузі біотехнології, конкретно до антагоністів гранулоцитарно-макрофагального колонієстимулюючого фактора (GM-CSF), і може бути використане в медицині. Винахід, що полягає у використанні антитіла, специфічного щодо GM-CSF у лікуванні або профілактиці розсіяного склерозу у пацієнтів з розсіяним склерозом, дозволяє затримати початок рецидивів розсіяного склерозу. 8 з.п. ф-ли, 5 іл., 8 пр.

Стабільні та розчинні антитіла, інгібуючі vegf

Винахід відноситься до області імунології та біотехнології. Представлені варіантні рекомбінантні антитіла проти VEGF людини, мають вариабельние галузі важкої та легкої ланцюгів, що містять гипервариабельне ділянки (CDR) антитіл кролика. Також представлені: виділені молекули нуклеїнових кислот, що кодують зазначені антитіла; вектор експресії, що містить зазначену молекулу нуклеїнової кислоти; і клітина-господар для експресії антитіла щодо винаходу, що містить зазначений вектор експресії. Описана фармацевтична композиція, що містить терапевтично ефективна кількість зазначеного антитіла і фармацевтично прийнятний носій. Винахід дозволяє розширити арсенал антитіл проти VEGF людини, отриманих від кролика. 7 н. і 17 з.п. ф-ли, 15 іл., 12 табл., 7 пр.

Моноклональні антитіла проти білка rgm а і їх застосування

Винахід відноситься до галузі біотехнології та імунології. Описані варіанти антитіл, що зв'язують молекулу GRM, а також їх антигенсвязивающие фрагменти, амінокислотні послідовності варіабельних областей яких представлені в матеріалах заявки. Представлена нуклеїнова кислота, що кодує зазначені антитіла. Запропоновано спосіб одержання білка, що зв'язує RGM, що включає культивування клітини-господаря в культуральному середовищі в умовах, відповідних для отримання зв'язуючого білка, здатного зв'язуватися з RGM, де клітина-господар містить вектор експресії, що містить виділену нуклеїнову кислоту, що кодує зазначене антитіло. Описана фармацевтична композиція для лікування захворювання, у якому активність RGM А чинить негативний вплив, що містить терапевтично ефективна кількість зазначеного антитіла і фармацевтично прийнятний носій. Запропоновано застосування зазначеного антитіла для одержання лікарського засобу, використовуваного для a) зниження зв'язування hRGM А з рецептором Neogenin хворого; або b) для зниження зв'язування hRGM А з ВМР-2 і ВМР-4 у хворого. Винахід дозволяє отримати антитіла проти GRM, які використовуються для лікування захворювань, зв &

Антитіло подвійної спрямованості в новій формі і його застосування

Винахід відноситься до галузі біотехнології та імунології. Представлено антитіло, яке являє собою нейтралізує антитіло проти VEGFR-2/KDR, гипервариабельние ділянки якого є ідентичними гипервариабельним ділянок антитіла TTAC 0001 проти VEGFR-2/KDR, злите зі зв'язуючим доменом ангиопоэтина 2, є лігандом Tie-2, для лікування раку за допомогою інгібування ангіогенезу. Також описані ДНК, що кодує зазначене антитіло; экспрессионний вектор, що містить зазначену ДНК; і клітина-господар CHO, трансформована зазначеним вектором, для отримання антитіла. Запропоновано спосіб отримання антитіла, що включає: інкубацію клітини-господаря, і виділення зазначеного антитіла з культуральної рідини клітини CHO. Описана фармацевтична композиція для лікування пов'язаного з ангиогенезом захворювання, що містить ефективне кількість зазначеного антитіла і щонайменше один фармацевтично прийнятний наповнювач. Винахід дозволяє отримати антитіло проти VEGFR-2/KDR, злите зі зв'язуючим доменом ангиопоэтина 2, яке може бути використане для ефективного лікування захворювання, пов'язаного з надмірною ангиогенезом. 6 н. і 7 з.п. ф-ли, 10 іл., 8 пр.

Твердофазний імуноферментний аналіз (elisa) для фактора росту ендотелію судин (vegf)

Винахід відноситься до області імунології, а саме до иммуноферментному аналізу, конкретніше до способу детекції форм фактора росту ендотелію судин (VEGF) c розміром більш ніж 110 амінокислот у біологічному зразку. Спосіб включає наступні стадії: контактування та інкубації біологічного зразка з реагентом захоплення, іммобілізованих на твердій підкладці, де реагент захоплення містить моноклональне антитіло, яке розпізнає і специфічно зв'язується з залишками, в кількості більш ніж 110, з VEGF людини; відділення біологічного зразка від іммобілізованих реагентів захоплення; контактування іммобілізованого молекулярного комплексу реагенту захоплення-мішені з детектируемим антитілом, яке пов'язується з доменами VEGF, відповідальними за зв'язування з рецептором KDR та/або FLT1, або яке пов'язується з эпитопом в VEGF1-110; вимірювання рівня VEGF110+, пов'язаного з реагентами захоплення з використанням кошти для детекції детектованого антитіла. Набір реагентів иммуноанализа для детекції форм VEGF110+ в біологічному зразку. Антитіло 5С3, що отримується з гибридоми 5С3.1.1 з депозитарною номером PTA-7737 big, при цьому зазначене антитіло 5С3 пов'язує форми VEGF110+, включаючи VEGF121+. Гибридома 5С3.1.1, депониров� винаходу дозволяє підвищити точність детектування ізоформ VEGF, які не повинні включати изоформу VEGF110 і при цьому повинні обов'язково включати изоформу VEGF121. 4 н. і 21 з.п. ф-ли, 3 іл., 2 табл., 1 пр.

Тимус-специфічний білок

Винахід відноситься до галузі біотехнології, конкретно до виділеного поліпептиду, його застосування та фармацевтичної композиції на основі даного виділеного поліпептиду. Виділений поліпептид являє собою фрагмент виділеного пептиду Т101 і складається з амінокислотної послідовності WWTFFLPSTLWERK, у якої щонайменше одна амінокислота замінена на відповідну D-амінокислоту. Запропоноване винахід може бути використаний в медицині для лікування аутоімунних та/або запальних захворювань. Винахід дозволяє отримати поліпептид, здатний індукувати проліферацію лімфоцитів периферичної крові (ЛПК) людини, інгібувати ріст пухлини і модулювати імунну систему. 4 н. п. ф-ли, 15 іл., 1 табл., 11 пр.
Up!