Модифіковані убиквитиновие білки зі специфічною зв'язує активністю для экстрадомена "в" фібронектину

 

ОБЛАСТЬ ТЕХНІКИ

Даний винахід відноситься до нових гетеромультимерним білків, здатних зв'язувати экстрадомен В фібронектину (ED-B). Крім того, винахід відноситься до складових білків, що включає згаданий гетеромультимерний зв'язуючий білок, об'єднаний з фармацевтично та/або діагностично активним компонентом. Винахід далі спрямовано на спосіб створення такого гетеромультимерного зв'язуючого білку або складеного білка і до фармацевтичним та/або діагностичним композиціям, що містить згадані гетеромультимерние зв'язуючі білки. Додатково, винахід відноситься до бібліотек, що містить ДНК, що кодують згадані білки.

В інших варіантах здійснення винахід спрямовано на полінуклеотиди, що кодують згаданий гетеромультимерний зв'язуючий білок або складовою білок, вектори, включають згаданий полинуклеотид, і клітини-господарі, що включають згаданий білок, складовою білок, вектор та/або полинуклеотид. В одному варіанті здійснення згаданий гетеромультимерний зв'язуючий білок або складовою білок включений в медикамент або діагностичний агент. Додатково, описані способи отримання згаданого реечения.

РІВЕНЬ ТЕХНІКИ

Існує зростаючий попит на зв'язують молекули, що складаються з амінокислот, які не є імуноглобулінами. Хоча на даний час антитіла являють собою найкраще вивчений клас зв'язують молекул, все ж існує необхідність у нових зв'язують молекулах, щоб отримати ліганди з високою спорідненістю та специфічністю, оскільки молекули імуноглобулінів мають великі недоліки. Хоча їх можна легко отримати і вони можуть бути спрямовані на будь-яку мішень, вони мають дуже складну молекулярну структуру. Існує постійна необхідність у заміщенні антитіл більш дрібними молекулами, з якими можна легко працювати. Ці альтернативні зв'язують агенти можуть бути з вигодою використані, наприклад, в медичних областях діагностики, профілактики і лікування захворювань.

Білки, що мають відносно визначені тривимірні структури, зазвичай звані білкові каркаси, можуть бути використані в якості вихідного матеріалу для конструювання згаданих альтернативних зв'язують агентів. Ці каркаси зазвичай містить один або більше областей, які схильні до специфічного або випадкового зміни последовательностибить обрані специфічні зв'язують молекули. Молекули меншого розміру ніж антитіла і з порівнянним або навіть більш гарним спорідненістю до цільового антигену будуть, як очікується, краще антитіл в сенсі фармакокінетичних властивостей та імуно-генности.

У кількох попередніх підходах дійсно використовують білкові каркаси в якості вихідного матеріалу для зв'язуючих білків. Наприклад, у документі WO 99/16873 описані розроблені модифіковані білки сімейства липокалинов (так звані антикалини), проявляють зв'язуючу активність для деяких лігандів. Структуру пептидів сімейства липокалинов модифікують шляхом заміщень амінокислот у їх природному зв'язує кишені, використовуючи способи генної інженерії. Подібно імуноглобулінів, ці антикалини можна використовувати для

ідентифікації або зв'язування молекулярних структур. Аналогічно антитілам, модифікують структури з гнучкою петлею; ці модифікації дають можливість розпізнавати ліганди, що відрізняються від природних.

У документі WO 01/04144 описано штучне створення зв'язуючого домену на поверхні білка в білках зі структурою бета-пласту як таких, у яких відсутня зв'язуючий сайт. За допомогою цього знову створеного штучного зв'язок� - �що взаємодіють з лігандами з високою спорідненістю та специфічністю. В протилежність модифікації сайтів зв'язування, які вже присутні і утворені з структур з гнучкою петлею, які згадані вище для антикалинов, ці домени зв'язування створюються заново на поверхні бета-пластів. Проте в документі WO 01/04144 описано тільки зміна відносно великих білків для створення нових зв'язуючих властивостей. З-за їх розміру, білки згідно WO 01/04144 можуть бути модифіковані на рівні генної інженерії тільки способами, які вимагають деяких зусиль. Крім того, в білках, розкритих досі, тільки відносно мала процентна частка всіх амінокислот модифікована для підтримки загальної структури білка. Тому тільки відносно невелика області поверхні білка доступна для створення зв'язуючих властивостей, які не існували раніше. Більш того, WO 01/04144 розкриває тільки створення властивості зв'язування з γ-кристаллином.

У документі WO 04/106368 описано створення штучних зв'язуючих білків на основі убиквитинових білків. Убіквітин - це невеликий, мономерний і цитозрль-ний білок, який у високій мірі зберігається в послідовності і присутній у всі�ву роль у регулюванні контрольованої деградації клітинних білків. Для цього білки, призначені для деградації, ковалентно зв'язуються з убиквитиновими або полиубиквитиновими ланцюгами під час їх проходження через каскад ферментів і вибірково деградують з-за цієї мітки. Згідно з останніми результатами, убіквітин або мічення білків убиквитином, відповідно, також відіграє важливу роль в інших клітинних процесах, таких як імпорт декількох білків або їх генне регулювання.

Крім прояснення його фізіологічної функції, убіквітин є об'єктом досліджень головним чином з-за його структурних і білково-хімічних властивостей. Полипептидная ланцюг убіквітину складається з 76 амінокислот, покладених в надзвичайно компактну α/β структуру (Віджай-Кумар (Vijay-Kumar), 1987): майже 87% цієї поліпептидного ланцюга бере участь у формуванні вторинних структурних елементів за допомогою водневих зв'язків. Вторинними структурами є 3,5 альфа-спіральні витки, а також антипараллельний бета-пласт, що складається з чотирьох ниток. Характерне розташування цих елементів - антипараллельний бета-пласт з відкритою поверхнею білкової, на задній стороні якої упакована альфа-спіраль, яка лежить вертикально на її верху - зазвичай вважається так званим убикви�нутрі білка між альфа-спіраль і бета-пластом.

З-за невеликого розміру штучне приготування убіквітину може бути здійснено як хімічним синтезом, так і за допомогою біотехнологічних методів. З-за сприятливих властивостей укладання убіквітин можна отримувати генною інженерією, використовуючи такі мікроорганізми, як Escherichia coli, у відносно великих кількостях або цитозоли, або в периплазматическом просторі. З-за окислюючих умов, що переважають у периплазме, остання стратегія зазвичай резервується для отримання секреторних білків. З-за простого і ефективного бактеріального приготування убіквітин можна використовувати як партнера в об'єднанні для інших одержуваних чужорідних білків, отримання яких викликає труднощі. За допомогою об'єднання з убиквитином можна досягти підвищеної розчинності і, за допомогою цього, підвищеного виходу продукту.

Порівняно з антитілами або іншими альтернативними каркасами, штучні зв'язуючі білки на основі убиквитинових білків (також званих Affilin®) мають багато переваг: невеликий розмір, висока стабільність, високу спорідненість, висока специфічність, економічне мікробне виробництво і регулювання сироваткового періоду полураспаих підходів з високими ступенями спорідненості зі специфічними мішенями. Хоча в документі WO 05/05730 описано в загальних рисах використання каркасів убіквітину для отримання штучних зв'язуючих білків, там не запропоновано рішення, як модифікувати убиквитиновий білок, щоб отримати специфічне і високоаффинное зв'язування з ED-В фібронектину.

У документі WO 2008/022759 описані рекомбінантні зв'язуючі білки, причому домен 3 (SH3) Src гомології FYN-кінази використовується для отримання нових зв'язуючих білків. Встановлено, що цільова субсидія може бути розроблена шляхом мутації RT-петлі та/або Src-петлі, щоб розробити білкову терапію та/або діагностику. Як і в липокалинах, що використовуються в якості каркаса, мутагенизируе-мі амінокислотні залишки лежать у варіабельних і гнучких областях петлею, імітуючи принцип, що лежить в основі зв'язує функції антитіл а/антигену. Ця загальна гнучкість сайту взаємодії, яким антитіла пов'язують епітоп, є в основному энтальпически проходять процесом; цей процес, однак, призводить до несприятливого энтропическому вкладом втратою мобільності при зв'язуванні гнучкої області, визначальною комплементарність. На противагу цьому, використовуючи убіквітин в якості каркаса, автори цього изобретенияасти бета-пласта або поруч з бета-нитками. Перевагою вибору амінокислотних залишків у не гнучких і жорстких бета-нитках або поруч з бета-нитками убіквітину в якості областей зв'язування для ED-B є, крім іншого, наступне: вважається, що зв'язуються партнери вже представляють комплементарну геометрію, підходящу для щільного зв'язування. Отже, ці взаємодії включають комплементарність у формі, заряд і гідрофільних/гідрофобних елементах більш жорстких структур що партнерів. Ці взаємодії твердих тіл оптимізують поверхню розділу і забезпечують біологічну функцію.

Фибронектини (FN) є важливим класом високомолекулярних позаклітинних матричних гликобелков, рясно експресованих в здорових тканинах і рідинах організму. Їх основна роль полягає в сприянні адгезії клітин до ряду різних позаклітинних матриксов.

Присутність фибронектинов на поверхні нетрансформированних клітин у культурі, а також їх відсутність у випадку трансформованих клітин призвели до ідентифікації фибронектинов як важливих адгезійних білків. Вони взаємодіють з численними іншими різними молекулами, наприклад, колагену, гепарансульфат-протеогліканів і фібрину і � диференціацію клітин під час ембріогенезу. Вони також відіграють важливу роль у лікуванні ран, у яких вони полегшують міграцію макрофагів та інших імунних клітин, і у формуванні згустків крові, дозволяючи адгезію тромбоцитів до пошкодженим областях кровоносних судин.

Экстрадомен (ED-B) фібронектину є невеликим доменом, який вводять альтернативним сплайсингом первинного транскрипту РНК в молекулу фібронектину. Ця молекула присутня або відсутня в молекулах фібронектину позаклітинного матриксу і представляє один з найбільш селективних маркерів, пов'язаних з ангиогенезом і ремоделюванням тканини, оскільки вона рясно експресується навколо нових кровоносних судин, але не може бути детектована практично у всіх нормальних тканинах дорослої людини (за винятком матки і яєчників). Відомо, що ED-B залучений головним чином в рак. Високі рівні експресії ED-B були детектировани в галузях первинного ураження, а також у місцях метастаз багатьох твердих ракових об'єктів у людини, включаючи грудної, недрібноклітинний легеневий, колоректальний, панкреатичний, шкірний, гепатоцелюлярний, внутричерепную менингеому, глиобластому (Менрад і Менссен (Menrad u. Menssen), 2005). Крім того, ED-B може бути пов'язаний з діаг�являється його використання в молекулярної візуалізації, наприклад, атеросклеротичних бляшок і детектування раку, наприклад, шляхом імуносцинтиграфії ракових пацієнтів. Також можливі інші способи використання в діагностиці.

Амінокислотна послідовність з 91 амінокислоти людського экстрадомена (ED-B) фібронектину показана в SEQ ID NO: 2. Для експресії білка доводиться додавати стартовий метіонін. ED-B рясно присутній у ссавців, наприклад, у гризунів, великої рогатої худоби, приматів, м'ясоїдних, людей і т. д. Прикладами тварин, у яких існує 100% ідентичність послідовності з ED-B людини, є Rattus norvegicus, Bos taurus, Mus musculus, Equus caballus, Macaca mulatta, Canis lupus familiaris і Pan troglodytes.

ED-B специфічно акумулюється в неоваскулярних структурах і являє мішень для молекулярної інтервенції в рак. Деяка кількість антитіл або фрагментів антитіл до домену ED-B фібронектину відомі в цій галузі як потенційні терапевтичні засоби для раку та інших показань (дивіться, наприклад, WO 97/45544, WO 07/054120, WO 99/58570, WO 01/62800). Фрагмент ScFvL19 антитіла Fv одиночної ланцюга людини (також іменований L19) є специфічним до домену ED-B фібронектину і, як підтверджено на експериментальних моделях пухлин, так і у пацієнтів й індустріаль�ти-ED-B антитіло або анти-ED-B фрагмент антитіла з цитокінами, такими як IL-12, IL-2, IL-10, IL-15, IL-24 або GM-CSF, були описані для ліків проти клітин-мішеней для виробництва медикаментів для інгібування, зокрема, раку, ангіогенезу зростання метастаз (дивіться, наприклад, WO 06/119897, WO 07/128563, WO 01/62298). Селективне націлювання на утворення нових судин у твердих пухлинах з допомогою анти-ED-B антитіл або анти-ED-B фрагментів антитіл, таких як L19, конъюгированньгх з відповідною функцією ефектора, такого як цитотоксичний або імуностимулюючий агент, виявилося успішним в експериментах на тварин. Для лікування раку підшлункової залози складові білки, що включають частину інтерлейкіну-2 (IL-2) та частина анти-ED-B антитіла, були об'єднані з невеликою молекулою гемцитабина (2'-деоксі-2'Д'- дифторцитидин) (дивіться, наприклад, WO 07/115837).

Вищевказані документи з існуючого рівня техніки описують використання різних каркасів білків, включаючи антитіла, для створення нових, що зв'язують ED-B білків. Таргетинг ED-B з доступними в даний час сполуками має певні недоліки. Більш малі молекули (такі як гетеромультимерние зв'язують ED-B білки цього винаходу на основі убіквітину) з порівнянним або навіть більш високою спорідненістю до антигену ED-B, як очік�ку рак представляє одну з провідних причин смертності у світі, існує зростаюча потреба в удосконалених агентів для лікування раку. Поточні хіміотерапевтичні агенти і лікування опроміненням мають погану селективність, і більшість хіміотерапевтичних агентів не акумулюються в місці пухлини і, таким чином, не можуть досягати адекватних рівнів пухлини. Існує сильна медична потреба в ефективному лікуванні раку.

Таким чином, мета цього винаходу полягає в тому, щоб запропонувати гетеромультимерние зв'язуючі білки на основі убіквітину, здатні специфічно зв'язуватися з дуже високою спорідненістю з позаклітинним доменом фібронектину (ED-B). Ще одна мета цього винаходу полягає в тому, щоб ідентифікувати і запропонувати нові зв'язуючі білки з дуже високою зв'язує специфічністю до ED-B, наприклад, для використання при лікуванні раку. Крім того, має бути запропонований спосіб, щоб отримувати згадані гетеромультимерние зв'язують молекули.

Вищевказані цілі вирішені предметом незалежних пунктів додається формули винаходу. Кращі варіанти здійснення винаходу включені в залежні пункти формули винаходу, а також у подальше опис, приклади иний пов'язувати ED-B фібронектину людини, включає модифікований гетеродимерний убиквитиновий білок, в якому два мономерних убіквітину (убиквитинових ланки) пов'язані між собою в розташуванні "голова до хвоста", причому кожен мономер згаданого димерного білка по-різному модифікований шляхом заміщення щонайменше 6 амінокислот у положеннях 2, 4, 6, 8, 62, 63, 64, 65, 66 і 68 SEQ ID NO: 1, і причому згадані заміщення включають

(1) в першому мономерном ланці заміщення щонайменше в амінокислотних положеннях 6, 8, 63, 64, 65 і 66;

у другому мономерном ланці заміщення щонайменше в амінокислотних положеннях 6, 8, 62, 63, 64, 65 і 66; за вибором додатково 2, або

(2) у першому мономерном ланці заміщення щонайменше в амінокислотних положеннях 2, 4, 6, 62, 63, 64, 65 і 66;

у другому мономерном ланці заміщення щонайменше в амінокислотних положеннях 6, 8, 62, 63, 64, 65 і 66; за вибором додатково 2,

і, по вибору, подальші модифікації, переважно заміщення інших амінокислот, причому згадане модифіковане мономерное убиквитиновое ланка має аминокислотную ідентичність з SEQ ID NO: 1 щонайменше на одне з групи 80%, щонайменше 83%, щонайменше 85%, щонайменше 83% і щонайменше 90%, і причому згаданий білок має з�і проявляє одновалентную зв'язуючу активність з згаданим экстрадоменом (ED-B) фібронектину.

В одному варіанті здійснення, білок є рекомбінантним.

В інших варіантах здійснення винаходу, 7, 8, 9 чи всі з амінокислот в положеннях 2,4, 6, 8, 62, 63, 64, 65, 66 і 68 SEQ ID NO: 1 модифіковані в кожному мономерном убиквитиновом ланці. Слід розуміти, що даний винахід дозволяє комбінацію кожної з цих варіацій у кожному мономерном ланці, тобто, в першому і другому ланці. Наприклад, перше мономерное ланка може включати 6 модифікацій, коли друга ланка включає 7 або 8 модифікацій, перша ланка може включати 8 модифікацій і друга ланка 7 модифікацій і т. д. Кожна з вищезгаданих амінокислот може бути обрана в першому і другому ланці, і потім обидва ланки об'єднують. Кращі заміщення описані нижче.

Визначення важливих термінів, які використовуються в цій заявці

Термін "экстрадомен В фібронектину" або скорочено вказується як "ED-B" включає всі білки, які показують ідентичність послідовності з SEQ ID NO: 2 щонайменше на 70%, за вибором на 75%, далі за вибором 80%, 85%, 90%, 95%, 96% або 97% або більше, або на 100% і які мають вишеопределенную функціональність ED-B.

Терміни "білок, здатний пов'язувати" або "связьшающий білок" відносяться до Ѿк на основі убіквітину може включати додаткові білкові домени, які не є связьшающими доменами, такі як, наприклад, рідини мультимеризации, поліпептидні мітки, поліпептидні линкери та/або молекули небілкових полімерів. Деякими прикладами молекул небілкових полімерів є гидроксиэтиловий крохмаль, поліетиленгліколь, поліпропіленгліколь або полиоксиалкилен.

Антитіла і їхні фрагменти добре відомі фахівця в даній області. Зв'язувальний білок винаходу не є антитілом або його фрагментом, таким як фрагменти Fab або scFv. Крім того, зв'язуючий домен винаходу не включає імуноглобулін, укладений як в антитіл.

У цьому описі винаходу терміни "ліганд" і "мішень" і "зв'язується партнер" використовуються як синоніми і можуть бути взаємно замінені. Лігандом є будь-яка молекула, здатна зв'язуватися зі спорідненістю, визначеним тут для гетеромультимерного модифікованого убиквитинового білка.

Термін "убиквитиновий білок" охоплює убіквітин відповідно до SEQ ID NO: 1 і його модифікації відповідно до такого визначення. Убіквітин у високій мірі зберігається в эукариотических організмах. Наприклад, у всіх ссавців,

досліджених до теперішнього часу, убіквітин має идентика, гризунів, свиней і приматів. Крім цього можна використовувати убіквітин з будь-якого іншого эукаритического джерела. Наприклад, убіквітин дріжджів відрізняється тільки трьома амінокислотами від послідовності SEQ ID NO: 1. Загалом, убиквитиновие білки, охоплюються згаданим терміном "убиквитиновий білок" показують аминокислотную ідентичність більш ніж 70%, переважно більш ніж 75% або більш ніж 80%», більш ніж 85%», більш ніж 90%», більш ніж 95%», більш ніж 96% або до ідентичності послідовності 97% з SEQ ID NO: 1.

Термін "модифікований убиквитиновий білок" відноситься до модифікації убиквитинового білка будь-яким одним із заміщення, вставок або вилучень амінокислот або їх поєднання, при цьому заміщення є найбільш переважними модифікаціями, які можуть бути доповнені будь-однієї з модифікацій, описаних вище. Число модифікацій строго обмежена, так як згадані модифіковані мономерні убиквитиновие ланки мають аминокислотную ідентичність з SEQ ID NO: 1 щонайменше одну з групи з 80%, щонайменше 83%, щонайменше 85%», щонайменше 83% і щонайменше 90%. Найбільше, загальне число заміщень в мономерном ланці тому обмежено 15 амінокислотами, соответствующле убіквітину становить 30 амінокислот, відповідних 20% амінокислотних модифікацій на основі гетеродимерного білка. Амінокислотна ідентичність димерного модифікованого убиквитинового білка порівняно з димерним немодифікованим убиквитиновим білком з основною мономерної послідовністю SEQ ID NO: 1 вибирається щонайменше як одне з групи 80%, щонайменше 83%, щонайменше 85%, щонайменше 83% і щонайменше 90%.

Для визначення ступеня ідентичності послідовності похідного убіквітину з амінокислотною послідовністю SEQ ID NO: 1, наприклад, можна використовувати програму SIM локального подібності (Сяокин Хуан і Уебб Міллер (Xiaoquin Huang and Webb Miller), "Досягнення прикладної математики, Том 12: 337-357,1991) або Клустал У. (Clustal, W.) (Томпсон та ін (Thompson et al.), Nucleic Acids Res., 22(22): 4673-4680,1994.).

Переважно, ступінь ідентичності послідовності модифікованого білка з SEQ ID NO: 1 визначають щодо повної послідовності SEQ ID NO: 1.

Тетеродимерним складовим білком" або "гетеродимерним білком" винаходу вважається білок, який включає два по-різному модифікованих мономерних убиквитинових білка з двома взаємодіючими зв'язуючими доменними областями, спільно забезпечують одновалмер отримують шляхом з'єднання двох мономерних молекул убіквітину, причому обидві ці молекули модифіковані по-різному, як описано в цьому документі.

Перевага мультимеризации по-різному модифікованих мономерів убіквітину для створення гетеромультимерних зв'язуючих білків (тут: гетеродимерние білки) з одновалентной зв'язує активністю полягає у збільшенні сукупного числа амінокислотних залишків, які можуть бути модифіковані для створення нового властивості високоаффинного зв'язування з ED-B. Основна перевага полягає в тому, що хоча модифікують навіть більше амінокислот, хімічна цілісність білка зберігається без погіршення загальної стабільності каркаса згаданого новоствореного білка зв'язування з ED-B. Сукупне число залишків, які можуть бути модифіковані, щоб створити новий зв'язуючий сайт для ED-В, збільшується, так як модифіковані залишки можуть бути розподілені на два мономерних убиквитинових білка. Число модифікацій тому може бути дорівнює двом, відповідаючи числа модифікованих молекул мономерного убіквітину. Модульна структура білка зв'язування з ED-B на основі убіквітину дозволяє збільшити загальне число модифікованих амінокислот, так як згадані модифіковані аминоЀних молекул убіквітину, мають одну одновалентную специфічність (епітопи) для ED-B.

Таким чином, використання гетеродимеров, що мають загальний сайт зв'язування що для партнерів, відкриває можливість вводити підвищену кількість модифікованих залишків, які не впливають неналежним чином на хімічну цілісність білка кінцевої зв'язує молекули, оскільки сукупна кількість цих модифікованих залишків розподілено за двома мономерним ланок, які утворюють димер. Згадані гетеродимерние модифіковані убиквитиновие білки, що зв'язуються з ED-B, представлені у бібліотеці білків.

"Одновалентний" повинен розумітися як можливість того, що обидві зв'язують області, створені в першому і другому мономерном ланці модифікованого димерного убіквітину, разом пов'язують ED-B синергистически і об'єднано, тобто, обидві зв'язують області діють спільно, щоб утворити одновалентную зв'язуючу активність. Якщо взяти окремо кожну зв'язкову область першого і другого модифікованого убіквітину у згаданій гетеродимерной молекулі, то така область очевидно буде пов'язувати ED-B з набагато меншою ефективністю і спорідненістю ніж димерная молекула. Обидві зв'язок� поверхні гетеродимерного модифікованого убиквитинового білка, так що згаданий модифікований убіквітин здатний зв'язуватися набагато більш ефективно з ED-B ніж кожен мономерний білок, взятий окремо. Особливо важливо, що, згідно з цим винаходу два мономерних білка не пов'язані між собою після скринінгу найбільш сильних зв'язують молекул убіквітину, але вже процес скринінгу виконується в присутності гетеродимерних убиквитинов. Після отримання інформації про послідовності за найбільш сильно зв'язує молекулам убіквітину ці молекули можуть бути отримані будь-яким іншим способом, наприклад, хімічним синтезом або способами генної інженерії, наприклад, шляхом зв'язування двох вже ідентифікованих мономерних убиквитинових ланок разом.

Згідно винаходу, два по-різному модифікованих мономерів убіквітину, які зв'язуються з одним лігандом, повинні бути пов'язані шляхом з'єднання "го-лову-до-хвоста" один з одним з використанням, наприклад, генетичних способів. Ці по-різному модифіковані об'єднані мономери убіквітину зв'язуються одновалентні і ефективні тільки якщо обидві області зв'язуючого домену" ("ОСД") діють спільно. "Область зв'язуючого домену" визначено як область на мономер�63, 64, 65, 66, 68 SEQ ID NO: 1, які беруть участь у зв'язуванні мішені.

Модифіковані і пов'язані мономери убіквітину, які утворюють гетероди-мірний білок, зв'язуються з тим же эпитопом через єдину суміжну связивающуюся область. Ця суміжна область гетеромера формується обома визначальними зв'язування областями двох модулів, сформованих двома по-різному модифікованими мономерами убіквітину.

"З'єднання голова до хвоста" повинно розумітися як з'єднання двох білків разом шляхом з'єднання їх в напрямку N-C-N-C-, в залежності від числа ланок, що містяться в димере. При цьому з'єднанні голова до хвоста мономери убіквітину можуть бути прямо з'єднані без будь-якого лінкера.

Альтернативно, з'єднання мономерів убіквітину може бути виконано за допомогою линкеров, наприклад, лінкера, має щонайменше аминокислотную послідовність GIG або має щонайменше аминокислотную послідовність SGGGG або будь-якого іншого лінкера, наприклад GIG, SGGGG, SGGGGIG, SGGGGSGGGGIG або SGGGGSGGGG. Відомі з рівня техніки і можуть бути використані і інші линкери для генетичного з'єднання двох мономерів убіквітину.

Модифіковані убиквитиновие білки винаходу сконструйовані з�меняемо). Термін "заміщення" також включає хімічну модифікацію амінокислот шляхом, наприклад, заміщення або додавання хімічних груп або залишків до вихідної амінокислоти. Заміщення амінокислот щонайменше в одній області з відкритою поверхнею білка, що включає амінокислоти, розташовані щонайменше в одній нитки бета-пласту області бета-пласту або приміщення до 3 амінокислот поруч з ниткою бета-пласту дуже важливо.

Заміщення амінокислот для створення нового зв'язується домену, специфічного для ED-B, може бути виконано згідно винаходу за допомогою будь бажаною амінокислоти, тобто, для модифікації, щоб створити нове зв'язується властивість до ED-B, необов'язково піклуватися про те, щоб амінокислоти мали якесь конкретне хімічна властивість або бічну ланцюг, відповідно, аналогічні таким у замещаемой амінокислоти, так що для цієї мети можна використовувати будь-яку бажану амінокислоту.

Етап модифікації вибраних амінокислот виконують, згідно винаходу, переважно шляхом мутагенезу на генетичному рівні шляхом неспецифічного мутагенезу, тобто, неспецифічним заміщенням вибраних амінокислот. Переважно, модифікацію убиквит�тельно, експресію убиквитинового білка потім здійснюють прокариотических або эукариотических організмах.

Заміщення виконують, зокрема, в амінокислотах з відкритою поверхнею чотирьох бета-ниток бета-пластів або амінокислотах з відкритою поверхнею до 3 амінокислот поруч з ниткою білка убіквітину нитки бета-пласту убиквитинового білка. Кожна бета-нитка зазвичай складається з 5-7 амінокислот. З посиланням на SEQ ID N0:1, наприклад, бета-нитки зазвичай включають амінокислотні залишки 2-7, 12-16, 41-45 і 65-71. Області, які можуть бути додатково і переважно модифіковані, включають положення до 3 амінокислот (тобто, 1, 2 або 3) поряд з ниткою бета-пласта.

Переважні області, які можуть бути додатково і переважно модифіковані, включають, зокрема, амінокислотні залишки 8-11, 62-64 та 72-75. Переважні області включають бета-витки, які пов'язують дві бета-нитки разом. Один переважний бета-виток включає амінокислотні залишки 62-64. Найбільш бажаною амінокислотою, яка розташована поруч з ниткою бета-пласту, є амінокислота в положенні 8. Крім того, іншими кращими прикладами заміщення амінокислот є положення 36, 44, 70 і/або 71. Напримеи 64 (3 амінокислоти), або 72, 73 (2 амінокислоти), або 8 (1 амінокислота).

У кращих варіантах здійснення амінокислотні залишки змінюють шляхом заміщень амінокислот. Однак припустимі також вилучення та вставки. Кількість амінокислот, які можуть бути додані або вилучені, обмежено 1, 2, 3, 4, 5, 6, 7 або 8 амінокислот у мономерном субзвене убіквітину і відповідно 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 амінокислот по відношенню до димерному убиквитиновому білку. В одному варіанті здійснення вставок амінокислот не роблять. Ще В одному варіанті здійснення не виконують вилучень.

За умови, що модифікований убиквитиновий білок цього винаходу включає додатково до згаданих заміщень, визначеним у формулі винаходу і поясненим тут, а також вилученням та/або додаванням однієї чи більше амінокислот, положення амінокислот для вихідного людського убіквітину (SEQ ID NO: 1) повинні бути вирівняні з модифікованим убиквитином, щоб виділити білки, що відповідають один одному. У разі складових білків (дивіться нижче), нумерація (вирівнювання) кожного з субзвеньев мономерного убіквітину здійснюють однаково, тобто, вирівнювання, наприклад, димера починають у положенні 1 аминокислотример, людини, щонайменше 10% амінокислот, присутніх в бета-нитках або положеннях до 3 амінокислот поруч з ниткою бета-пласту, переважно щонайменше 20%, більш переважно щонайменше 25%, можуть бути модифіковані, переважно заміщені, згідно з цим винаходу, щоб створити зв'язуюча властивість, яке раніше не існувало. Як максимум, переважно приблизно 50% амінокислот, присутніх в бета-нитках або положеннях до 3 амінокислот поруч з ниткою бета-пласту, більш переважно, як максимум, приблизно 40%, або приблизно 35%, або приблизно 30%, або приблизно 25% є модифікованими, переважно заміщеними. В одній бета-нитки зазвичай модифіковані 1-4 амінокислоти. В одному варіанті здійснення три з шести амінокислот переважно в першій і четвертій бета-нитках, наприклад, в області амінокислотних залишків 2-7 або 65-71, модифіковані.

Модифікований мономерний убіквітин згідно винаходу, використовуваний як будівельне ланка для гетеродимера, налічує в сукупності до 20% амінокислот. Враховуючи це, існує ідентичність послідовності з SEQ ID NO: 1 модифікованого убиквитинового беминокислотном рівні становить щонайменше 83%, щонайменше 85%, щонайменше 87% і, крім того, щонайменше 90%, щонайменше 92% або щонайменше 95% ідентичності послідовності з амінокислотною послідовністю SEQ ID NO: 1. Винахід також охоплює ідентичності амінокислотної послідовності модифікованого убиквитинового білка більш ніж на 97%» порівняно з амінокислотною послідовністю SEQ ID NO: 1.

Ще В одному варіанті здійснення винаходу убіквітин модифікований на 3, або 4, або 5, або 6, або 7 амінокислот у положеннях 2, 4, 6, 8, 62, 63, 64, 65, 66 та/або 68 SEQ ID NO: 1. Ще В одному варіанті здійснення убіквітин, який потрібно модифікувати в цих положеннях, вже попередньо модифікований. Наприклад, інші модифікації можуть включати модифікації в амінокислотах 74 і 75 або амінокислоти 45, щоб створити підвищену стабільність чи хімічні властивості білка. Може бути отриманий модифікований мономер убіквітину, в якому в сукупності до 9, 10, 11, 12, 13, 14 і максимум 15 амінокислот убіквітину з SEQ ID NO: 1 модифіковані, переважно заміщені. Згідно одному прикладу, може бути отриманий модифікований мономерний убіквітин, що має 14 заміщень та одне вилучення. На підставі сукупного числа амінокислот упоскольку зазвичай набагато меншого відсотка вже достатньо для порушення укладання білка.

В одному варіанті здійснення винаходу ці амінокислоти модифікують для створення області, що має нові властивості зв'язування ED-B, які утворюють безперервну область на поверхні білка. Таким чином може бути створена безперервна область, яка має властивість зв'язування з ED-B. "Безперервна область" згідно винаходу відноситься до наступного: з-за заряду, просторової структури та гідрофобності/гідрофільності своїх бічних ланцюгів амінокислоти взаємодіють з навколишнім їх середовищем відповідним чином. Цієї навколишнім середовищем може бути розчинник, зазвичай вода, або інші молекули, наприклад, просторово близькі амінокислоти. За допомогою структурної інформації про білку, а також відповідного програмного забезпечення можна охарактеризувати поверхню білків. Наприклад, область поверхні розділу між атомами білка і розчинником можна візуалізувати цим образом, включаючи інформацію про те, як структурована ця область поверхні розділу, які частини поверхні доступні для розчинника, або як на поверхні розподілені заряди. Безперервна область може бути розкрита, наприклад, візуалізацією цього типу з використанням відповідного п�, в основному, також всю область з відкритою поверхнею можна використовувати в якості безперервної області на поверхні, яку потрібно модифікувати для створення нових зв'язуючих властивостей. В одному варіанті для здійснення цієї мети модифікація може також включати альфа-спіральну область. У гетеродимерном модифікованому убиквитиновом білку область, визначає зв'язування, включає дві з областей з відкритою поверхнею, що утворюють разом одну безперервну область, яка включає дві довжини однієї області, визначальною зв'язування.

Модифікація амінокислот щонайменше в одній області білка з відкритою поверхнею, що включає щонайменше одну бета-нитка області бета-пласта або положення до 3 амінокислот поруч з ниткою бета-шару є дуже важливою. "Структура бета-пласту" визначається як сутності пластоподобная і майже повністю розтягнута. В протилежність альфа-спіралях, які сформовані з непорушеного сегмента поліпептидного ланцюга, бета-пласти можуть бути сформовані різними областями поліпептидного ланцюга. Цим образом області, віддалені один від одного далі в первинній структурі, можуть увійти в тісну близькість один з одним. Бета-нитка обичю. Бета-нитки підходять так близько один до одного, що утворюються водневі зв'язки між групою З-O однієї нитки і групою NH іншої нитки і навпаки. Бета-пласти можуть бути сформовані з кількох ниток і мають пластоподобную структуру, в якій положення альфа-атомів З чергується між положеннями вище і нижче пластової площині. Бічні ланцюги амінокислот дотримуються цієї моделі і, таким чином, альтернативно вказують вгору або вниз. В залежності від орієнтації бета-ниток, пласти класифікують на паралельні і антипараллельние. Згідно винаходу, обидва типи можуть мутувати і використовуватися для приготування запропонованих білків.

Для мутагенезу бета-ниток та структури бета-пласту в убиквитине вибирають бета-нитка або положення до 3 амінокислот поруч з бета-ниткою (яка є ниткою бета-пласту), які близько до поверхні. Амінокислоти з відкритою поверхнею можуть бути ідентифіковані по відношенню до доступної рентгенівської кристалографічною структурою. Якщо кристалічна структура не доступна, можна зробити спроби передбачити допомогою комп'ютерного аналізу області бета-пласту з відкритою поверхнею і доступність індивідуальних положень амінокислот отношотенциальних амінокислотах з відкритою поверхнею таким чином. Подальше розкриття цього питання можна взяти, наприклад, у J. Mol. Товарbiol, 1987 Apr 5; 194(3):531-44. Vijay-Kumar S, Bugg C. E., Cook W. J.

Однак також можна здійснити модифікації в бета-пласті чи положеннях до 3 амінокислот поруч з бета-ниткою, для яких віднімає багато часу попередній вибір положень амінокислот для мутагенезу можна опустити. Області ДНК, що кодують структури бета-пластів або до 3 амінокислот поруч з ниткою бета-пласту ізолюють від їх ДНК навколишнього середовища, піддають неспецифічного мутагенезу і потім повторно інтегрують в ДНК кодування для білка, з якого вони були видалені раніше. За цим слідує процес вибору мутантів з бажаними властивостями зв'язування.

Ще В одному варіанті здійснення винаходу бета-нитки або до 3 амінокислот поруч з бета-ниткою близько до поверхні вибирають як сказано вище та ідентифікують положення амінокислот для мутагенезу в цих обраних областях. Положення амінокислот, вибрані таким чином, можна потім піддати мутагенезу на рівні ДНК або шляхом спрямованого на сайт мутагенезу, тобто, кодон, що кодує специфічну амінокислоту заміщають кодоном, кодирующим іншу, раніше обрану специфічну амінокислоту, або це заміщення про�оти, але не кодон, що кодує нову, ще не певну амінокислоту.

"Амінокислотами з відкритою поверхнею" є амінокислоти, які доступні для навколишнього розчинника. Якщо доступність амінокислот у білку більше ніж 8% порівняно з доступністю амінокислоти в модельному трипептиде Gly-X-Gly, ці амінокислоти називають" поверхнево відкритими". Ці області білка або положення окремих амінокислот, відповідно, також є переважними сайтами зв'язування для потенційних що партнерів, вибір яких повинен бути здійснений згідно винаходу. Крім цього, робиться посилання на публікації Кастера та ін. (Caster et al), 1983 Science, 221, 709 - 713, і Шрейка і Ріплі (Shrake & Rupley), 1973 J. Mol. Товарbiol. 79(2):351-371, які для повного розкриття включені в дану заявку шляхом посилання.

Варіації каркаса убиквитинового білка, що відрізняються заміщеннями амінокислот в області штучного сайту зв'язування, знову створеного з батьківського білка і один одного, можуть бути створені шляхом цільового мутагенезу відповідних сегментів послідовності. У цьому випадку амінокислоти, що мають деякі властивості, такі як полярність, заряд, розчинність, гідрофобність або гідрофільність�мо заміщень, терміни "мутагенез" і "модифікований" і "замінений" також включають вставки та вилучення. На білковому рівні модифікації також можуть бути здійснені шляхом зміни хімічного бічних ланцюгів амінокислот згідно способам, відомим фахівцям в даній області.

Способи мутагенезу убіквітину

В якості вихідної точки для мутагенезу відповідних сегментів послідовності можна використовувати, наприклад, кДНК убіквітину, яка може бути приготована, змінена і амплифицирована способами, відомими фахівцям в даній області. Комерційно доступні реагенти та способи для сайт-специфічного зміни убіквітину у відносно невеликих областях первинної послідовності (приблизно 1-3 амінокислоти) ("Quick Change", компанія Stratagene; набір "Mutagene Phagemid in vitro Mutagenesis Kit", компанія Biorad). Для сайт-спрямованого мутагенезу більш великих областей фахівцям доступні специфічні варіанти здійснення, наприклад, полімеразна ланцюгова реакція (ПЛР). Для цієї мети можна використовувати суміш синтетичних олигодеоксинуклеотидов, мають композиції вироджених пар основ в бажаних положеннях, наприклад, для введення мутації. Це також можна здійснити шляхом викори� інозин.

Вихідною точкою для мутагенезу однієї або більше бета-ниток області бета-пласта або положень до 3 амінокислот поруч з ниткою бета-пласту може бути, наприклад, кДНК убіквітину або також геномна ДНК. Крім того, генне кодування для убиквитинового білка також може бути приготовлено синтетично.

Відомими і доступними різними процедурами для мутагенезу є способи сайт-специфічного мутагенезу, способи неспецифічного мутагенезу, мутагенез з використанням ПЛР або схожі способи.

В одному варіанті здійснення винаходу попередньо визначені положення амінокислот для мутагенезу. Вибір амінокислот для модифікації здійснюють, щоб відповідати вимогам пункту 1 формули винаходу стосовно тих амінокислот, які необхідно модифікувати. У кожному випадку зазвичай створюють бібліотеки різних мутантів, яку піддають скринінгу, використовуючи способи, відомі як такі. Зазвичай попередній вибір амінокислот для модифікації може бути особливо легко виконаний, оскільки для убиквитинового білка, що підлягає модифікації доступно достатньо структурної інформації.

Способи цільового мутагенезу, а також мутаг�льзуя бактеріальні штами гена-мутатора також входять в рівень техніки і можуть бути використані згідно винаходу.

В одному варіанті здійснення винаходу мутагенез здійснюють складанням олі-гонуклеотидов ДНК, що несуть кодон NNK амінокислоти. Необхідно розуміти, однак, що можна використовувати й інші кодони (триплети). Мутації виконують таким чином, щоб краще зберегти структуру бета-пласту. Зазвичай мутагенез відбувається на зовнішній стороні стабільної області бета-пласту, відкритої на поверхні білка. Він включає і сайт-специфічний і неспецифічний мутагенез.

Сайт-специфічний мутагенез, включає відносно невелику область в первинній структурі (приблизно 3-5 амінокислот), може бути створений з використанням наявних у продажу наборів Stratagene® (QuickChange®) або Bio-Rad® (Mutagene® phagemid in vitro mutagenesis kit) (див. US 5,789,166; US 4,873,192).

Якщо сайт-специфічного мутагенезу піддають більш широкі області, повинна бути підготовлена ДНК-касета, в якій область для мутагенезу отримують складанням нуклеотидів, що містять мутовані і незмінені положення (Норд та ін. (Nord et al), 1997 Nat. Biotechnol. 8,772-777; Макконелл і Xecc (McConell and Hoess), 1995 J. Mol. Товарbiol. 250,460-470.). Неспецифічний мутагенез може бути введений шляхом поширення ДНК в штами гена-мутатора або ампліфікацією ПЛР (підвладна помилок ПЛР) (нибок. Для посилення ступеня введеного мутагенезу або для об'єднання різних мутацій, відповідно, мутації у фрагментах ПЛР можна об'єднувати за допомогою перестановки ДНК (Штеммер (Stemmer), 1994 Nature 370, 389-391). Огляд цих стратегій мутагенезу по відношенню до ферментам представлений в огляді Кюхнера і Арнольда (Kuchner and Arnold) (1997) TIBTECH 15, 523-530. Для здійснення цього неспецифічного мутагенезу в обраній галузі ДНК також повинна бути сконструйована ДНК-касета, яку використовують для мутагенезу.

Неспецифічну модифікацію виконують способами, які добре освоєні і добре відомі в цій галузі. "Неспецифічно модифікований нуклеотид або амінокислотна послідовність" є нуклеотидом або амінокислотною послідовністю, який в декількох положеннях був підданий вставці, вилученню або заміщення нуклеотидами або амінокислотами, характер яких не можна прогнозувати. У багатьох випадках введені неспецифічні нуклеотиди (амінокислоти) або послідовності нуклеотидів (амінокислот) будуть "повністю неспецифічними" (наприклад, як наслідок рандомізованого синтезу або ПЛР-опосередкованого мутагенезу). Однак неспецифічні послідовності також мо�ировать з лігандом продукту експресії), або неспецифічні послідовності можуть бути неспецифічними в тому сенсі, що кінцевий продукт експресії є повністю неспецифічної послідовністю, наприклад, з рівномірним розподілом різних амінокислот.

Для того, щоб ввести рандомізовані фрагменти вектори правильно, згідно винаходу бажано, щоб неспецифічні нуклеотиди вводили в вектор експресії за принципом сайт-спрямованого, ПЛР-опосередкованого мутагенезу. Однак спеціалісту відомі й інші варіанти, і, наприклад, можна вводити бібліотеки синтетичних неспецифічних послідовностей вектори.

Для створення мутантів або бібліотек шляхом об'єднує ПЛР можуть виконуватися, наприклад, три реакції ПЛР. Дві реакції ПЛР виконують для створення частково перекриваються проміжних фрагментів. Третю реакцію ПЛР виконують для об'єднання проміжних фрагментів.

Спосіб конструювання бібліотеки або варіантів мутантів може включати конструювання першого набору праймерів навколо бажаного рестрикційного сайту (праймер рестрикційного сайту), праймера прямої та зворотної рестрикції і другого набору праймерів навколо, наприклад, перед і за ко�ті здійснення праймери конструюють відразу ж перед і за, відповідно, кодоном, що представляють інтерес. Рестрикційні і мутагенні праймери використовують для конструювання першого проміжного та другого проміжного фрагментів. Дві реакції ПЛР створюють ці лінійні проміжні фрагменти. Кожен з цих лінійних проміжних фрагментів включає щонайменше один мутований кодон, що представляє інтерес, фланкувальну нуклеотидну послідовність і сайт розщеплення. Третя реакція ПЛР використовує ці два проміжних фрагмента і праймери прямої та зворотної рестрикції для виробництва об'єднаного лінійного продукту. Навпаки, досі незакріплені кінці лінійного продукту розщеплювали з допомогою рестрикційного ферменту, щоб створити липкі кінці на лінійному продукті. Липкі кінці лінійного продукту об'єднують шляхом використання ДНК-лігази, щоб отримати кільцевої продукт, наприклад, кільцеву полинуклео-тидную послідовність.

Для конструювання проміжних фрагментів виконують розробку і синтез двох наборів прямих і зворотних праймерів, причому перший набір містить сайт розщеплення рестрикційних ферментів разом з його фланкирующей нуклеотидної послідовністю, і другий набір содеробласти зрозуміють, що кількість варіантів буде залежати від кількості варіантів бажаних модифікацій амінокислот. Автор цього винаходу передбачає, що якщо в цьому процесі будуть використані інші рестрикційні ферменти, точне місцезнаходження цього сайту розщеплення і відповідна послідовність прямих і зворотних праймерів можуть бути змінені відповідно. У рівні техніки доступні інші способи, і вони можуть бути використані замість викладеного.

Крім введення рандомізованого фрагмента продукту експресії в каркас згідно з цим винаходом, часто необхідно з'єднати неспецифічну послідовність з партнером по об'єднанню шляхом об'єднання рандомизированной нуклеотидної послідовності з нуклеотидної послідовністю, кодує щонайменше одного партнера з об'єднання. Таке партнер по об'єднанню може, наприклад, сприяти експресії, та/або очищення/ізоляції, та/або подальшої стабілізації продукту експресії.

Неспецифічне заміщення згідно одному прикладу цього винаходу щонайменше 6 амінокислот у положеннях 2,4, 6, 8, 62,63, 64, 65, 66 та/або 68 мономерного убіквітину може бути виконано особ� білка. Відповідно, кодони для маніпулювання знаходяться на 5' 3' кінці відповідної нитки кДНК. Таким чином, перший олигодеоксинуклеотид, використовуваний для мутагенної реакції ПЛР крім кодонов в положеннях 2,4, 6 та/або 8, які будуть мутувати, відповідає за кодуючої послідовності нитки для аміно-закінчення убіквітину. Відповідно, другий олигодеоксинуклеотид - крім кодонов в положеннях 62,63, 64,65,66 та/або 68, які будуть мутувати, щонайменше частково відповідає некодирующей нитки поліпептидного послідовності карбокси-закінчення. За допомогою обох олигодеоксинуклеотидов полиме-різна ланцюгова реакція може бути виконана з використанням ДНК-послідовності, що кодує мономерний убіквітин, в якості шаблону.

Крім того, отриманий продукт ампліфікації може бути доданий до іншої полімеразної ланцюгової реакції з використанням фланкують олигодеоксинуклеотидов, які вводять, наприклад, послідовності розпізнавання для рестрикційних эндонуклеаз. Згідно винаходу бажано вводити отриману генну касету у векторну систему, придатну для використання у подальшій процедурі селекції для ізоляції варіацій убіквітину, �ції в убиквитине

Області для модифікації можуть бути обрані в залежності від того, що вони можуть бути доступні для ED-B як зв'язується партнера, і від того, що загальна структура білка буде приблизно виявляти толерантність до модифікації.

Крім модифікацій поверхнево відкритих бета-нитках, також можуть бути здійснені модифікації в інших поверхнево відкритих областях білка, переважно в положеннях до 3 амінокислот поруч з бета-ниткою. Ці модифіковані області беруть участь у новостворюваному зв'язування з високою спорідненістю з ED-B.

Ще В одному варіанті здійснення цього винаходу амінокислоти в одній або двох, переважно двох, чотирьох бета-ниток у білку або в положеннях до 3 амінокислот поруч переважно з двома з чотирьох бета-ниток модифікують, щоб створити нове зв'язуюча властивість. Також, за вибором, може бути здійснена модифікація в трьох або чотирьох з чотирьох бета-ниток або в положеннях до 3 амінокислот поряд з трьома або чотирма з бета-ниток для створення зв'язування з ED-B.

Зокрема бажано, щоб амінокислоти в нитки аміно-закінчення і карбок-сі-закінчення або в положеннях до 3 амінокислот поруч з ниткою аміно-окончя з ED-B. В цьому відношенні, зокрема кращий, щоб до 4 амінокислот поруч з ниткою карбокси-закінчення бета-пласту були модифіковані, переважно заміщені, і 1 амінокислота поруч з ниткою аміно-закінчення бета-пласту була модифікована, переважно заміщена. Зокрема кращою є модифікація, переважно заміщення, щонайменше в трьох поверхнево відкритих амінокислотах наступних положень убіквітину ссавця, переважно убіквітину людини: 2, 4, 6, 8, 62, 63, 64, 65, 66, 68. Ці щонайменше чотири амінокислоти з згаданої групи з 5 амінокислот формують безперервну поверхнево відкриту область на поверхні убіквітину, яка, як було з'ясовано, зокрема підходить для створення модифікованих білків, що мають зв'язує спорідненість, яке не існувало раніше по відношенню до ED-B як связивающемуся партнеру. Щонайменше 3 з цих амінокислотних залишків повинні бути модифіковані. За вибором, 3, 4, 5, 6, 7, 8, 9 або 10 згаданих амінокислотних залишків модифікують, за вибором, в поєднанні з додатковими амінокислотними залишками.

Після здійснення вищезгаданих модифікацій автори винаходу знайшли послідовності убикв�ом (значення килодальтон до 10-9).

Складові білки

У ще одному варіанті здійснення винахід відноситься до складеного білку, що включає зв'язуючий білок винаходу, об'єднаний з фармацевтично та/або діагностично активним компонентом.

У ще одному аспекті винахід відноситься до складеного білку, що включає гетеродимерний зв'язуючий білок винаходу, об'єднаний з фармацевтично та/або діагностично активним компонентом. Складовою білок винаходу може включати не поліпептидні компоненти, наприклад, не пептидні линкери, не пептидні ліганди, наприклад, для терапевтично або діагностично релевантних радионуклеотидов. Він також може включати невеликі органічні або не амінокислотні з'єднання, наприклад, цукор, оліго - або полісахарид, жирну кислоту і т. д. В одному варіанті здійснення винаходу молекула на основі гетеромерного убіквітину, що зв'язує ED-B, ковалентно або не ковалентно конъюгирована з білком або пептидом, мають терапевтично або діагностично релевантні властивості.

Нижче наведені деякі приклади того, як отримати складові білки на основі убіквітину зі здатністю зв'язувати ED-B.

a) Конъюга�е гетеродимерного убіквітину через цистеїнові залишки - можуть бути розташовані в С-закінчення або в будь-якому іншому положенні (наприклад, амінокислотний залишок 24 або 57); кон'югація з малеимидними вибираними компонентами.

c) Пептидні або протеиногенние кон'югації - генетичні об'єднання (переважно З - або N-закінчення).

d) Об'єднання на основі "міток" - білок або пептид, який розташований у С - або N-закінчення білка-мішені ED-B. "Мітки" об'єднання, наприклад, полигистидин (зокрема релевантний для радиомечения).

Ці та інші способи ковалентного і не ковалентного прикріплення представляє інтерес білка до підкладці добре відомі в цій галузі і тому більш детально тут не описані.

За вибором, згаданий активний компонент є цитокіном, переважно цитокіном, вибираемим з групи, що складається з факторів некрозу пухлин (наприклад, TNF-α, TNF-бета), інтерлейкінів (наприклад, IL-2, IL-12, IL-10, IL-15, IL-24, IL-3, IL-4, IL-5, IL-6, IL-7, IL-9, IL-11, IL-13, IL-8, IL-1-альфа, IL-1-бета), інтерферонів (наприклад, IFN-α, IFN-бета, IFN-гамма), GM-CSF, GRO (GRO-альфа, GRO-бета, GRO-гама), MIP (MIP-1-альфа, MIP-1-бета, MIP-3-альфа, MIP-3-бета), TGF-бета LIF1 CD80, CD-40 ліганд, 70, LT-бета, Fas-ліганд, ENA-78, LDGF-PBP, GCP-2, PF4, Mig, IP-10, SDF-1 альфа/бета, BUNZO/STRC33,l-TAC, BLC/BCA-1, MDC, ТЕСК, TARC, RANTES, НСС-1, НСС-4, DC-CK1, МСР-1-5, Эотаксин, Эотв для використання в цьому винаході є TNF-альфа. Запальний цитокін TNF має численні види активності в організмі ссавця, включаючи протипухлинний ефект, який в даний час клінічно иррелевантен з-за неприйнятною токсичності ефективних доз для людини. В даний час TNF терапевтично використовують у поєднанні з цитостатичними субстанціями, такими як мелфалан.

Далі за вибором, згаданий активний компонент, який може бути конъюгирован з гетеромультимерним зв'язуючим білком на основі убіквітину, є токсичним з'єднанням, переважно, невеликим органічним з'єднанням або поліпептидом, за вибором токсичним з'єднанням, наприклад, вибираемим з групи, що складається з сапорина, усіченого синьогнійної екзотоксину А, рекомбінантного гелонина, ланцюги рицину-А, каличеамицина, неокарциностатина, эсперамицина, динеми-цина, кедарцидина, мадуропептина, доксорубіцину, даунорубицина, ауристатина, холерного токсину, модеццина, дифтерійного токсину.

Ще В одному варіанті здійснення винаходу гетеромультимерний зв'язуючий білок на основі убіквітину згідно винаходу може містити штучні амінокислоти.

В інших варіантах здійснення складеного белко компонентом, вибираемим з групи радіонукліда, або з групи гамма-випромінюючих ізотопів, переважно 99Tc, 123i, 111In, або з групи випромінювачів позитронів, переважно 18F, 64Cu, 68Ga, 86Y, 124Iабо з групи бета-випромінювач, переважно 131I90Y, 177Lu, 67Cu, або з групи альфа-випромінювач, переважно 213Bi, 211At; барвниками Alexa Fluor або циановими (Берлиер та ін. (Berlier et al.), J Histochem Cytochem. 51 (12): 1699-1712, 2003); фотосенсибілізатором; прокоа-гулянтним фактором, переважно тканинним фактором (наприклад, tTF-усіченим тканинним фактором); ферментом для активації проліки, переважно ферментом, вибираемим з групи, що складається з карбоксипептидаз, глюкуронидаз і глюкозидаз; та/або функціональним Fc доменом, переважно функціональним Fc доменом людини.

Ще один варіант здійснення відноситься до складових білків згідно винаходу, крім того що включає компонент, модуляційний період напіврозпаду сироватки, переважно компонентом, вибираемим з групи, що складається з поліетиленовою-ленгликоля, альбумін-зв'язуючих пептидів і імуноглобуліну.

Специфічності зв'язування (константи дисоціації)

Специфич�, виражені в килодальтонах. Згідно з винаходом, термін "килодальтон" визначає специфічне зв'язує спорідненість, яке відповідно до винахід знаходиться в діапазоні від 10-7до 10-12М. Значення 10-5М і нижче може вважатися висловлюваним кількісно зв'язує спорідненістю. Залежно від застосування, значення 10-7М-10-11М переважно, наприклад, для хроматографічних застосувань або 10-7-10-12М наприклад, для діагностичних або терапевтичних застосувань. Інші бажані значення зв'язує спорідненості лежать в діапазоні від 107до 10-10М, переважно до 10-11М.

Способи визначення значень зв'язує спорідненості відомі як такі і можуть бути обрані, наприклад, з наступних: ІФА, технологія на основі поверхневого плазмонного резонансу (ППР) (що пропонується, наприклад, Biacore®), флуоресцентна спектроскопія, ізотермічна титриметрическая калориметрія (ІТК), аналітичне ультрацентрифугування, збуджена флуоресценція сортованих клітин.

Після здійснення вищезгаданих модифікацій автори винаходу знайшли, що послідовності убіквітину з модифікованими аминоки�-10М).

Дімерізація убіквітину

У цьому винаході "димером" вважається білок, який включає два мономерних убиквитинових білка. Якщо димер включає два по-різному модифікованих мономеру, він називається "гетеромерний димер" або "гетеродимер". Таким чином, "гетеродимер" винаходу вважається об'єднанням двох по-різному модифікованих мономерних убиквитинових білків, що мають об'єднане одновалентних зв'язуюча властивість для специфічного зв'язується партнера ED-B.

Необхідно підкреслити, що модифікований гетеродимерний зв'язує ED-B убиквитиновий білок винаходи не можна отримати шляхом роздільного скринінгу кожного мономерного убиквитинового білка і об'єднання двох з них згодом, але можна отримати шляхом скринінгу на гетеродимерние білки, що складаються з першого і другого мономерної ланки, які разом виявляють одновалентную связьшающую активність з згаданим лігандом ED-B. Слід очікувати, що кожне із згаданих субзвеньев проявляє цілком обмежена зв'язна спорідненість до ED-B, тоді як тільки об'єднаний димерний модифікований убиквитиновий білок буде мати чудові зв'язують властивості, описані в цьому дотина, генетично пов'язані шляхом об'єднання "голова до хвоста", зв'язуються з одним і тим же эпитопом ED-B і ефективні тільки, якщо обидві області зв'язується домену діють разом. ОСД мономерів утворюють одну безперервну область зв'язування.

Таким чином, убиквитиновий білок, модифікований у відповідності з винаходом, димеризован для ефективного зв'язування ED-B фібронектину. Мономери можуть бути з'єднані безпосередньо або через линкери, як сказано вище. Можна використовувати багато відомих линкери.

Кожен мономерний убіквітин має модифікації щонайменше в шести амінокислотах 2, 4, 6, 8, 62, 63, 64, 65, 66, 68. Мономерні білки генетично об'єднані один з одним. Зв'язування з мішенню опосередковано згаданими ОСД спільно, тобто, ОСД взаємодіють між собою і формують одну загальну область зв'язування, здатну зв'язуватися з згаданим доменом ED-B фібронектину одновалентним чином.

Гетеродимери модифікованого убіквітину зв'язуються з ED-B Гетеродимер убіквітину згідно винаходу, зв'язується з ED-B з кД=10-7-10-2М і виявляє активність одновалентного зв'язування щодо згаданого экстрадомен (ED-B) фібронектину, вибирають з двох насту� 65 і 66; і

у другому мономерном ланці заміщення щонайменше в амінокислотних положеннях 6, 8, 62, 63, 64, 65 і 66; за вибором додатково 2, і

(2) у першому мономерном ланці заміщення щонайменше в амінокислотних положеннях 2,4, 6, 62, 63, 64, 65, і 66;

у другому мономерном ланці заміщення щонайменше в амінокислотних положеннях 6, 8, 62, 63, 64, 65 і 66; за вибором додатково 2.

В одному варіанті здійснення складовою білок є генетично об'єднаним гетеродимером згаданого мономеру убіквітину, що має заміщення в амінокислотах в положеннях 6, 8, 63-66 першого мономеру убіквітину і заміщення в амінокислотних залишків в положеннях 6, 8, 62-66, і за вибором в положенні 2 другого мономеру убіквітину, переважно:

- у першому мономере убіквітину заміщення

лізину (K) на триптофан (W) або фенілаланін (F) в положенні 6,

лейкина (L) на триптофан або фенілаланін (W, F) у положенні 8, 30,

лізину (K) на аргінін (R) або гістидин (Н) у положенні 63,

глютамінову кислоту (Е) на лізин (K), аргінін (R) або гістидин (Н) у положенні 64,

серії (S) на фенілаланін (F) або триптофан (W) у положенні 65 і треонін (Т) на пролін (P) у положенні 66;

- у другому мономере убіквітину кращі заміщення

лізину (K)спарагин (N) або серії (S) у положенні 8,

глутамін (Q) на триптофан (W) або фенілаланін (F) у положенні 62,

лізину (K) на серії (S), треонін (Т), аспарагін (N) або глутамін (Q) у положенні 63,

глютамінову кислоту (Е) на аспарагін (N), серії (S), треонін (Т), або глутамін (Q) у положенні 64,

серії (S) на фенілаланін (F) або триптофан (W) у положенні 65, і

треонін (Т) на глютамінову кислоту (Е) або аспарагінову кислоту (D) у положенні 66, і

за вибором, глутамін (Q) на аргінін (R), гістидин (Н) або лізин (До) у положенні 2.

Ці альтернативні заміщення в кожному мономере можуть бути об'єднані один з одним без будь-яких обмежень за умови, що отримуються гетеродимери модифікованого убіквітину мають специфічну активність зв'язування з згаданим экстрадоменом (ED-B) фібронектину кД=10-7-10-12М і проявляють активність одновалентного зв'язування щодо згаданого экстрадомена (ED-B) фібронектину, і за умови, що структурна стабільність убиквитинового білка не зруйнована або не порушена.

Найбільш вагомими є наступні заміщення:

(1) в першому мономерном ланці щонайменше K6W, L8W, K63R, E64K, S65F і Т66Р;

і в другому мономерном ланці щонайменше K6T, L8Q, Q62W, K63S, E64N, S65W, і Т66Е; за вибором дод�ланці щонайменше K6X, L8x, Q62X, K63X, Е64Х, S65X, і Т66Х; за вибором додатково Q2X, де X може бути будь амінокислотою (див. Фіг.2).

Зокрема, переважними є такі заміщення в першому мономере убіквітину для створення білків зв'язування з ED-B

2: Q→T, 4: F→W, 6: K→Н, 62: Q→N, 63: K→F, 64: Е→K, 65: S→L, 66: T→S

Для з'єднання двох мономерів "голова до хвоста" можна використовувати або не використовувати лінкер. Переважними є линкери SEQ ID NO: 32 або послідовність GIG, або SGGGGIG, або SGGGGSGGGGIG.

В одному варіанті здійснення, гетеродимер убіквітину з двома областями, визначальними зв'язування (ОСД) і спільно діють для зв'язування ED-B, включає аминокислотную послідовність SEQ ID NO: 33 або 34. Ще один переважний білок представлений наступною послідовністю, в якій ХХХХ може бути будь амінокислотою (SEQ ID NO: 47). Тут в якості лінкера використаний SGGGGSGGGGIG. При цьому розуміється, що також можливий інший вид линкеров або, альтернативно, відсутність лінкера.

:MTIWVHTLTGKTITLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIWAGKQLEDGRTLSDYNINFKLSLHLVLRLRGGSGGGGSGGGGIG

MQIFVXTXTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIWAGKQLEDGRTLSDYNINXXXXXLHLVLRLRGG

Консенсусні послідовності прикладів білків з цими послідовностями показані на Фіг.2.

Пред�та, має послідовність SEQ ID NO: 35 або 36.

У ще одному аспекті даний винахід також охоплює полінуклеотиди, які відповідають за створення білка або складеного білка, як сказано вище. Додатково, винахід охоплює вектори, що включають згаданий полинуклеотид.

У додатковому аспекті цього винаходу охоплені клітини-господарі, які містять білок або складовою білок, описаний тут, та/або полинуклеотид для створення згаданого рекомбінантного білка або складеного білка винаходу або вектор, що містить згаданий полинуклеотид.

Використання білків винаходи, наприклад, зв'язуючих білків на основі гетеродимерного убіквітину, специфічно для об'єднання ED-B з ефекторів, таких як TNF-альфа

Білки зв'язування модифікованого убіквітину з ED-B згідно винаходу повинні використовуватися, наприклад, для приготування діагностичних засобів для використання in vitro або in vivo, а також терапевтичних засобів. Білки згідно винаходу можуть використовуватися, наприклад, як молекули прямого ефектора (модулятора, антагоніста, агоніста) або антиген-розпізнавальних доменів. Приклади пухлин з рясним проявом ED-B антигену показані в таблиці адаптована для спрямованості на лікування раку, наприклад, грудей і колоректальних раків, або на будь-які інші пухлинні захворювання з частим проявом ED-B (дивіться приклади на Фіг.1).

Композиції адаптовані для утримання терапевтично ефективної дози. Величина призначеної дози залежить від організму пацієнта, типу захворювання, віку та маси тіла пацієнта, а також інших факторів, відомих як такі.

Композиції містять фармацевтично або діагностично прийнятний носій і, по вибору, можуть містити інші допоміжні агенти і наповнювачі, відомі як такі. Вони включають, наприклад, але без обмеження, стабілізуючі агенти, поверхнево-активні речовини, солі, буфери, подкрашивающие агенти і т. д.

Фармацевтична композиція може бути у формі рідкого препарату, крему, лосьйону для топікального застосування, аерозолі, порошків, гранул, таблеток, супозиторіїв або капсул, емульсії або ліпосомного препарату. Композиції переважно стерильні, непирогенние і изотонние і містять фармацевтично традиційні і прийнятні добавки, відомі як такі. Додатково, робиться посилання на правила Фармакопеї США або публікацію "Фармацевтичні науки Ремінгтона", Травні Publishing Company (1990).

У обласѿо щонайменше один гетеромерний убиквитиновий білок, модифікований у відповідності з винаходом, для зв'язування ED-B може бути приготовлено способами, відомими як такі. Залежно від галенового препарату, ці композиції можуть бути введені парэнтерально шляхом ін'єкції або інфузії, системно, ректально, інтраперитонеально, внутрішньом'язово, підшкірно, чрезкожно або іншими традиційно застосовуваними способами. Тип фармацевтичного препарату залежить від типу захворювання, тяжкості захворювання, пацієнта та інших факторів, відомих фахівців в області медицини.

В одному варіанті здійснення фармацевтична композиція містить білок або складовою білок винаходу або їх поєднання і, крім того, містить один або більше хіміотерапевтичних агентів, переважно вибираються з таблиці:

Клас речовиниПриклади
Алкілуючі агенти (АТС L01 А)мелфалан, циклофосфамід
Антиметаболіти (АТС L01B)5-фторурацил, гемцитабін
Таксани(АТС L01CD)паклЀубицин, ліпосомний док-сорубицин
Сполуки платини (АТС L01XA)цисплатин

В одному варіанті здійснення, хіміотерапевтичний агент вибирають з мелфалан, доксорубіцину, циклофосфаміду, дактиномицина, фтордезок-сиурацила, цисплатину, паклітакселу і гемцитабина; або з групи інгібіторів ки-нази.

"Фармацевтична композиція" згідно винаходу може бути у формі композиції, в якій різні активні інгредієнти та розріджувачі та/або носії змішані один з одним, або може приймати форму об'єднаного препарату, в якому активні інгредієнти присутні в частково або повністю роздільної формі. Прикладом такої композиції або об'єднаного препарату є набір.

"Композиція" згідно з цим винаходу включає щонайменше два фармакологічно активних сполук. Ці сполуки можуть бути введені одночасно або окремо з тимчасовим інтервалом від однієї хвилини до декількох діб. З'єднання можуть бути введені однаковим способом або по-різному; наприклад, можливе пероральне введення одного активного з'єднання і парэнтеральное введення іншого соедкак набір, містить обидва з'єднання окремо. Також можливо, щоб обидва з'єднання були присутні у двох або більше упаковках.

Зокрема, кращою комбінацією є складовою білок згідно винаходу і мелфалан та/або (ліпосомний) доксорубіцин. Крім неопластичних агентів з класу АТС L01, TNF-складовою білок винаходу може бути об'єднаний з іншими антинеопластичними речовинами, включаючи цитокіни та їх похідні, радиофармацевтическими препаратами, клітинними терапевтичними препаратами і наночастинками.

З-за його активності проникнення в пухлину, TNF-складовою білок винаходу (а також інші рекомбінантні білки/складові білки цього винаходу) може бути об'єднаний з антинеопластичними агентами, які вказані в рубриці L01 Системи класифікації анатомико-терапевтичних хімічних речовин (АТС), що надається Всесвітньою організацією охорони здоров'я.

Автори винаходу несподівано з'ясували, що складовою білок з гетеродимера убіквітину, об'єднаного з TNF-альфа, причому складовою білок переважно має послідовність SEQ ID NO: 35 або 36, може бути з вигодою застосований в терапії. TNF-альфа є високо токсичним речовиною і, такимрога (і, таким чином, терапевтично неактивні). Із-за токсичності TNF-альфа, щоб досягти терапевтично ефективній концентрації, в даний час при використанні TNF-альфа вибирають підхід перфузії в ізольовану кінцівку. Перфузія в кінцівку є медичним прийомом, який можна використовувати для доставки протиракових ліків безпосередньо в руку або ногу. Потік крові в кінцівку і з неї тимчасово припиняють за допомогою кровоспинного джгута і протиракові ліки вводять безпосередньо в кров кінцівки. Це дозволяє пацієнтові отримувати більшу дозу TNF-альфа в тій області, де має місце рак.

Однак, шляхом застосування TNF-альфа складових білків цього винаходу, можна вводити TNF-альфа в не токсичною, але все ж терапевтично ефективній концентрації. Оскільки TNF-альфа з'єднаний з (зв'язуючою) складовим білком цього винаходу, він може бути безпосередньо активним у місці захворювання (наприклад, місці пухлини) і, таким чином, кількість "вільного" TNF-альфа може бути різко скорочено.

Системні побічні ефекти TNF-альфа можуть бути помітно знижені шляхом введення TNF-альфа як складового білка відповідно до цього винаходу. Шляхом�єкта таким чином може бути значно зменшена і може з вигодою використовувати для лікування системної пухлини (без необхідності і обмежень перфузії в кінцівку), зокрема в поєднанні з хіміотерапевтичними агентами (дивіться вище).

Ще В одному варіанті здійснення фармацевтична композиція знаходиться у формі набору з частин, що передбачає окремі позиції для рекомбінантного убиквитинового білка/складеного білка винаходи і для одного або більше хіміотерапевтичних агентів.

Спосіб отримання гетеродимерних, що зв'язують ED-B білків винаходу

Білки, що зв'язують ED-B згідно винаходу, можуть бути приготовлені будь-яким з багатьох традиційних і добре відомих способів, таких як прості стратегії органічного синтезу, способи твердофазного синтезу або в наявних у продажу автоматизованих синтезаторах. З іншого боку, вони також можуть бути приготовані традиційними рекомбінантними способами як такими або в поєднанні з традиційними способами синтезу.

У ще одному аспекті цього винаходу запропоновано спосіб створення рекомби-нантного модифікованого убиквитинового білка. Цей спосіб включає щонайменше наступні етапи:

а) надання популяції по-різному модифікованих димеризованих убиквитинових білків, що відбуваються з мономерних убиквитинових білків, причому згадана анних разом в розташуванні "голова до хвоста", причому кожен мономер згаданого димерного білка по-різному модифікований шляхом заміщення щонайменше 6 амінокислот у положеннях 2,4,6, 8, 62, 63, 64, 65, 66 і 68 SEQ ID NO: 1

причому згадані заміщення включають:

В одному аспекті винаходу згадану популяцію по-різному модифікованих білків отримують шляхом генетичного об'єднання двох бібліотек ДНК, кожна з яких відповідає за одержання по-різному модифікованих мономерних убиквитинових білків.

У ще одному аспекті згаданий спосіб адаптований так, щоб об'єднати згаданий модифікований гетеродимерний убиквитиновий білок з фармацевтично активним компонентом, за вибором цитокіном, переважно TNF-альфа, або діагностичним компонентом, або в якому згаданий рекомбінантний модифікований гетеродимерний убиквитиновий білок сформований за допомогою згаданого фармацевтично активного компонента, яким, на вибір, є TNF-альфа, або за допомогою згаданого діагностичного компонента.

Згідно винаходу, модифікований білок також може бути приготований хімічним синтезом. У цьому варіанті здійснення етапи з) - d) пункту 1 формули винаходу тоді виконують в один етап.

модифікованих мономерньгх убиквитинових білків, як сказано вище, які формують основу для отримання гетеродимерних убиквитинових білків винаходу.

У ще одному аспекті винаходу представлена бібліотека об'єднань, що містить ДНК, отримані шляхом об'єднання двох бібліотек, як сказано вище, причому кожна бібліотека відповідає за одержання ланок по-різному модифікованих мономерних убиквитинових білків, щоб отримати гетеродимерние складові білки убіквітину, і причому їх мономерні ланки пов'язані між собою в розташуванні "голова до хвоста", і згадана бібліотека відповідає за гетеродимерние складові білки убіквітину, проявляють одновалентную зв'язуючу активність щодо згаданого экстрадомена (ED-B) фібронектину. Згадане зв'язування між собою виконують або використовуючи будь-який з линкеров, відомий спеціаліст в даній галузі, або лінкер, описаний у цьому документі. В одному варіанті здійснення винаходу TNF-альфа використовують як лінкер, одночасно діє як фармацевтично активне з'єднання.

У Прикладі 1 описано отримання складної бібліотеки. Однак необхідно проявляти обережність стосовно якості такої бібліотеки. Якість бібліотеки в каркасної технології �урная і білково-хімічна цілісність одержуваних кандидатів). Обидві характеристики, однак, можуть чинити негативний вплив один на одного: підвищення складності бібліотеки шляхом збільшення числа модифікованих положень на каркасі може призвести до погіршення білково-хімічних характеристик варіантів. Це може призвести до погіршеною розчинності, аггрегации та/або низького виходу продукту. Причиною цього є підвищена відхилення від вихідних каркасів, мають енергетично сприятливий упаковку білка.

Тому при конструюванні такої бібліотеки каркасів потрібен відповідний баланс між крайніми положеннями введення максимально можливого числа варіацій в оригінальну послідовність, щоб оптимізувати її для мішені і, з іншого боку, зберегти оригінальну первинну послідовність у максимальній мірі, щоб уникнути негативних білково-хімічних впливів.

Слід сказати, що даний розкриття також охоплює кожну можливу комбінацію описаних тут ознак у плані аспектів або варіантів здійснення винаходу.

Вибір модифікованих убиквитинових білків зі зв'язуючою спорідненість відносно мішені ED-B та визначення модифікованих амінокислот, що відповідають за связиветеродимерних модифікованих убиквитинових білків, шляхом різних модифікацій вибраних амінокислот в кожному з мономерних ланок убіквітину ці бібліотеки генетично об'єднують, наприклад, за линкерной технології, щоб отримати молекули ДНК, що відповідають за отримання гетеродимерних модифікованих убиквитинових білків. ДНК цих бібліотек експресують в білки, і отримані таким чином модифіковані димерні білки вводять в контакт згідно винаходу з ED-B, щоб, по вибору, дозволити зв'язування партнерів один з одним, якщо зв'язує спорідненість існує.

Дуже важливий аспект винаходу полягає в тому, що процес контакту і скринінгу виконують вже по відношенню до гетеродимерному убиквитиновому білку. Цей процес дозволяє виконувати скринінг на тих убиквитинових білках, які володіють активністю одновалентного зв'язування з ED-B.

Згідно винаходу контакт переважно виконують за допомогою відповідного способу подання й вибору, як такого фаговий дисплей, рибосомний дисплей, мРНК дисплей або способи дисплея поверхонь клітин, дисплея поверхонь дріжджів або дисплея поверхонь бактерій, переважно за допомогою способу фагового дисплею. Для повноти розкриття посилання робиться так�des and Proteins - A Laboratory Manual (1996), Academic Press. Вищевказані способи відомі фахівцям в даній області і можуть бути використані згідно винаходу, включаючи їхні модифікації.

Визначення того, чи має модифікований білок обчислюване кількісно зв'язує спорідненість по відношенню до попередньо визначеного связивающемуся партнерові може бути виконано, згідно винаходу, переважно одним або декількома з наступних способів: ІФА, спектроскопія методом поверхневого плазмонного резонансу, флуоресцентна спектроскопія, збудженої флуоресценцією сортованих клітин (FACS), ізотермічної титриметрической калориметрией і аналітичним ультрацентрифугированием.

Спосіб вибору фаговим дисплеєм

Один тип процедури фагового дисплею, адаптований до цієї заявці описаний далі як приклад вибору згідно винаходу по відношенню до варіацій убіквітину, які проявляють зв'язують властивості. Таким же чином можуть бути застосовані, наприклад, засоби для подання на бактеріях (бактеріальний поверхневий дисплей; Daugherty et al., 1998, Protein Eng. 11(9):825-832) або дріжджових клітинах (yeast surface display; Kieke et al, 1997 Protein Eng. 10(11): 1303-10) або безклітинні системи вибору, такі як рибосомни�tl Acad Sci USA. 101 (9):2806-2810) або мРНК дисплей. В останньому випадку тимчасова фізична зв'язок генотипу і фенотипу досягається шляхом з'єднання варіації білка з відповідної мРНК через рибосому.

В описаній тут процедурі фагового дисплею рекомбінантні варіації убіквітину представлені на нитчатом фаге, тоді як кодує ДНК представленої варіації представлена в той же час упакованої в однониткову форму в фаговой оболонці. Таким чином, в рамках афінного збагачення варіації, які мають певні властивості, які можуть бути обрані з бібліотеки, та їх генетична інформація може бути амплифицирована шляхом інфекції відповідних бактерій або додана до іншого циклу збагачення, відповідно. Подання мутованого убіквітину фага на поверхні досягається шляхом генетичного об'єднання з сигнальної послідовністю з аміно-закінченням, переважно з PelB сигнальної послідовністю, і капсид або поверхневий білок переважного фага є кар-бокситерминальним об'єднанням з капсидним білком рШ або його фрагментом.

Крім того, отриманий складовою білок може містити інші функціональні елементи, такі як мітка спорідненості або епітоп антитіла для дітей.�тичного розщеплення складного білка в ході афінного збагачення. Крім того, термінатор UAG може бути представлений, наприклад, між геном для варіації убіквітину і кодує областю капсидного білка фага або його фрагмента, який не розпізнано під час трансляції у відповідний супрессорний штам, частково із-за введення однієї амінокислоти.

Бактеріальний вектор, відповідний для процедури вибору в контексті ізоляції варіацій убіквітину з властивостями зв'язування з ED-B та в який введена генна касета для описуваного складеного, називається фагемидом. Серед інших, він містить межгенную область нитчатого фага (наприклад, М13 або f1) або її частина, яка у випадку бактеріальної суперінфекції клітки, несучої фагемид допомогою фагів-

хелперів, таких як, наприклад, M13K07, призводить до закритій упаковці нитки ДНК фагемида в капсид фага. Створені таким чином фагемиди секретуються бактеріями і представляють відповідну варіацію убіквітину, кодовану за її об'єднання з капсидним білком pIII або його фрагментом, на їх поверхні. Нативні капсидние білкиpIIIприсутні в фагемиде, так що його здатність реинфицировать відповідні бактеріальні штами, і тому можливість амплифицировать відповідну ДНК зберігається. Таким обра властивість, і її генотипом.

Отримані фагемиди можуть бути обрані по відношенню до зв'язування представленої на них варіації убіквітину з ED-B способами, відомими фахівцям в даній області. Для цієї мети представлені варіації убіквітину можуть бути тимчасово іммобілізовані на субстанції мішені, пов'язаної, наприклад, на микротитровальних планшетах, і можуть бути специфічно элюировани після відділення не що варіацій. Элюирование переважно виконують лужними розчинами, такими як, наприклад, 100 мМ триетиламін. Альтернативно, элюирование може бути виконано в кислих умовах, шляхом протеолізу або прямого додавання інфікованих бактерій. Фагемиди, отримані таким чином, можуть бути реамплифицировани і збагачені послідовними циклами вибору і ампліфікації варіацій убіквітину з властивостями зв'язування з ED-B.

Подальша характеризація варіацій убіквітину, отриманих таким чином, може бути виконана у формі фагемида, тобто, об'єднаних з фагом, або після клонування відповідної генної касети у відповідний экспрессирующий вектор в формі розчинного білка. Відповідні способи відомі фахівцям в даній області або описані в літературі. Характ�ельности ізольованих варіацій. Крім того, спорідненість і специфічність ізольованих варіацій можна детектувати стандартними біохімічними способами, такими як ІФА або спектроскопія поверхневого плазмонного резонансу, флуоресцентна спектроскопія, FACS, ізотермічна титриметрическая калориметрія, аналітичне ультрацентрифугування та ін.. У світлі аналізу стабільності, наприклад, спектроскопічні способи в зв'язку з хімічним або фізичним розгортанням відомі фахівцям в даній області.

Спосіб вибору рибосомним дисплеєм

Ще В одному варіанті здійснення винаходу варіації убіквітину для процедури рибосомному дисплея готують допомогою безклітинної системи транскрипції/трансляції та представляють комплекс з відповідної мРНК, а також рибосомой. Для цієї мети бібліотеку ДНК, яка описана вище, використовують в якості основи, в якій гени варіацій присутні у формі об'єднань з відповідними регуляторними послідовностями для експресії і біосинтезу білка. Через вилучення терминирующего кодона у закінченні 3' генної бібліотеки, а також відповідних експериментальних умов (низька температура, висока концентрація Mg) тричастинний комплекс, що складається з вознотеки білків, містить гетеродимерние модифіковані убиквитиновие білки, шляхом різних модифікацій вибраних амінокислот в кожному з мономерних ланок убіквітину модифіковані димерні білки вводять в контакт, згідно винаходу, з ED-B, щоб дозволити партнерам зв'язуватися один з одним, якщо існує зв'язує спорідненість. Ці бібліотеки білків можуть бути у формі відображення бібліотеки дисплейним способом, або можна використовувати будь-який інший спосіб, який представляє модифіковані білки таким чином, щоб забезпечити контакт між модифікованими білками і білком-мішенню ED-B, причому згаданий дисплейний спосіб є, по вибору, фаговим дисплеєм, рибосомним дисплеєм, дисплеєм фага ТАТ, дріжджовим дисплеєм, бактеріальним дисплеєм або дисплеєм мРНК.

Вибір модифікованих варіацій убіквітину по відношенню до їх активності зв'язування з ED-B 20 при специфічному зв'язує спорідненості в кД в діапазоні 10-7-10-12М може бути виконано способами, відомими фахівцям в даній області. Для цієї мети варіації убіквітину, представлені, наприклад, на рибосомних комплексах, можуть бути тимчасово іммобілізовані на субстанції мішені, пов'язаної, наприклад, на микротитровалсле відділення несвязиваю трудящих варіацій генетична інформація варіацій зі зв'язує активністю може бути специфічно элюирована у формі мРНК шляхом деструкції рибосомному комплексу. Элюирование переважно здійснюють з 50 мМ ЕДТА. Отримана таким чином мРНК може бути ізольована і назад транскрибирована в ДНК з використанням відповідних способів (реакція зворотної транскриптази), і ДНК, отримана таким чином, може бути реамплифицирована.

За допомогою послідовних циклів транскрипції in vitro/трансляції, вибору і ампліфікації варіації убіквітину з властивостями зв'язування з певним гаптеном або антигеном можуть бути збагачені.

Характеризація білків, що з EDB

Подальша характеризація варіацій убіквітину, отриманих таким чином, може бути виконана у формі розчинного білка, як докладно сказано вище, після клонування відповідної генної касети у відповідний экспрессирующий вектор. Відповідні способи відомі фахівцям в даній області або описані в літературі.

Переважно, за етапом детектування білків, що мають зв'язує спорідненість відносно певного зв'язується партнера, слід етап ізоляції та/або збагачення детектованого білка.

Після експресії убиквитинового білка, модифікованого згідно винаходу, він може бути далі очищений і збагачений способами, известнимй області, наприклад, використовуваного экспрессирующего вектора, організму-господаря, наміченої галузі використання, розміру білка і інших факторів. Для спрощення очищення білок, модифікований згідно винаходу, може бути об'єднаний з іншими пептидними послідовностями, що мають підвищену спорідненість з матеріалами поділу. Переважно, вибирають такі об'єднання, які не надають шкідливого впливу на функціональність убиквитинового білка або можуть бути відокремлені після очищення з-за введення специфічних сайтів розщеплення протеази. Такі способи також відомі як такі фахівцям в даній області.

КОРОТКИЙ ОПИС КРЕСЛЕНЬ

На Фіг.1 показана таблиця ч зазначенням зустрічальності ED-B в різних пухлинах.

на Фіг.2 показано консенсусні положенні і заміщення амінокислот у ще 16 послідовностях, які, як було з'ясовано, мають дивно сильне зв'язує спорідненість з ED-B. Консенсусними положеннями амінокислот у першій мономерної області, визначальною зв'язування, є 2,4,6, 62,63, 64, 65, 66, а консенсусними заміщеннями амінокислот є Q2T, F4W, K6H, Q62N, K63F, E64K, S65L і T66S. Як можна зрозуміти з Фіг.2, 4 сімейства послідовностей можуть бути збагачені (консенся положення в гетеродимерном білку; щодо другого мономеру відповідними положеннями є 6 і 8; 141-145 відповідають положенням 62-64). TWH NFKLS, відображена в темно-синьому кольорі, відбувається 1071-З 12. Залишки, позначені червоним кольором, відносяться до одного із згаданих чотирьох сімейств послідовностей. Залишки, позначені червоним, були переважно збагачені (178/457 послідовностей) і включають, згідно ІФА, найбільш сильні зв'язують молекули.

На Фіг.3 показано, що тетрамеризация призводить до підвищення спорідненості.

В таблиці показані значення кД модифікованих мономерів убіквітину порівняно з тетрамерами, що складаються з модифікованих мономерів убіквітину. Як приклади, показані варіанти 5Е1 і 1Н4 убіквітину. Зв'язування ED-B порівнюється зі зв'язуванням з c-FN (клітинний фібронектин). Ці Фігури демонструють значно більш високу спорідненість до зв'язування тетрамерного варіанти (наприклад, 56 нМ для 5Е1 або 1,4 нМ для 1Н4) з мішенню ED-B порівняно з мономером (4,51 мкМ для 5Е1 або 9,98 мкМ для 1Н4).

На Фіг.4 показано, що рекомбінація переднього (першого) модифікованого мономеру убіквітину (має BDR1) з іншим, модифікованим заднім (другим) мономером убіквітину (мають BDR2) для створення гетеродим�їна проаналізовано допомогою Biacore, флуоресцентної анізотропії, зв'язування на клітинах і зрізах тканин. Показано залежать від концентрації результати ІФА (конц. - ІФА) зв'язування декількох варіантів з ED-B людини.

На Фіг.4А показано спорідненість пов'язує кД=9,45 мкМ для мономеру 41В10.

На Фіг.4В показано, що зв'язує спорідненість кД=131 нМ для 41 В10, об'єднаного з іншим, другим мономером, призводить до 46Н9.

На Фіг.5 показано специфічні варіанти, об'єднані з цитокіном (наприклад, TNF-альфа). Ці складові білки тримеризуют модифікований мономер убіквітину і є біологічно активними молекулами.

На Фіг.5 А наведено схематичний креслення загального білка - ефектора, що зв'язує ED-B на основі модифікованого убіквітину; зелений (структура нагорі) - ефектор, наприклад, цитокін, переважно TNF-альфа; коричневий: світло-коричневий: структура модифікованих мономерів убіквітину (Affilin®).

На Фіг.5 показано, що кон'югат ефектора модифікованого убіквітину 5Е1-TNF-кон'югат має про-апоптическую активність (вимірювану в аналізі апоптозу L929).

На Фіг.5 показано високоаффинное зв'язування 1Н4-тар-альфа-об'єднання з ED-В (кД=15,1 нМ) (зафарбовані кола, сполучені підігнаної лінією). Зв'язування з BSA�ктивность молекули гетородимера, связивающейся з ED-B, на основі модифікованого убіквітину, об'єднаної з цитокіном, наприклад, TNF-альфа.

- Индуцирующая апоптоз активність об'єднання цитокіну, що зв'язується з ED-B, на основі модифікованого убіквітину: ЄС500,78±0,24 пМ

- Индуцирующая апоптоз активність вільного цитокіну: ЄС503,14±3,59 пМ

На Фіг.6А показано спорідненість гетеродимера 24Н12 (кД 50,7 нМ), що зв'язує ED-B, на основі модифікованого убіквітину.

На Фіг.6В показано спорідненість гетеродимера 24Н12, що зв'язує ED-B, на основі модифікованого убіквітину, генетично об'єднаного з цитокіном TNF-альфа, щоб привести до мультимеризации гетеродимера 24Н12 (кД=5,6 нМ).

На Фіг.6С показаний аналіз прикладів кандидатів з обраної бібліотеки гетероди-мірного модифікованого убіквітину, наприклад, клони 9Е12, 22D1, 24Н12, 41В10 гетеродимера. Значення ІФА в килодальтонах збільшуються для мішені ED-B порівняно з цитозольним фибронектином, використовуваним в якості контрольного, підтверджуючи специфічне зв'язування з мішенню.

На Фіг.6D показані результати аналізу молекули 9Е12 модифікованого гетеро-димерного убіквітину допомогою аналізів взаємодії без міток з використанням Biacore®. Були проаналізова�ля зв'язування з ED-В, иммобилизованном на чіпі (Biacore), щоб проаналізувати взаємодію між гетеродимерним варіантом 9Е12 і ED-B. Значення в килодальтонах не можна визначити з аналізу кривих асоціації і дисоціації.

На Фіг.6Е показані результати аналізу молекули 41 В10 модифікованого гетеродимерного убіквітину допомогою аналізів взаємодій без міток з використанням Biacore®. Були проаналізовані різні концентрації варіантів гетероди-мірного убіквітину (дивіться легенду до Фігури: 0-15 мкМ 41 В10) для зв'язування з ED-B, иммобилизованном на чіпі (Biacore), щоб проаналізувати взаємодію між гетеродимерним варіантом 41В10 і ED-B. Аналіз кривих асоціації і дисоціації дав значення кД 623 нМ (623×10-9М, 6,2×10-7М).

На Фіг.7 показано внесок різних варіантів на основі модифікованого убіквітину в зв'язує спорідненість і специфічність. Ці різні варіанти поділяють модулі загальної послідовності, які позначені літерами нижнього регістру. Варіанти були проаналізовані щодо їх зв'язування з ED-B. На Фіг.3 показані інші комбінації мономерів, що дають гетеродимери модифікованого убіквітину. Гетеродимерние варіанти 46-А5, 50-G11 і 46-Н4 мають однаковий перший (передній) модифицирова�азних положеннях. Варіанти 52-D10 і 52-В3 мають інший перший (передній) модифікований мономер по порівнянні з 46-Н9 з BDR1, але однаковий другий (задній) мономер убіквітину з BDR2 (позначено літерою "е").

Гетеродимери модифікованого убіквітину мають наступні послідовності:

46-Н4: SEQ IDNO: 25, 45-Н9: SEQ IDNO: 26, 46-А5: SEQ IDNO: 27, 50-G11: SEQ ID NO: 28, 52-В3: SEQ ID NO: 29, 52-D10: SEQ ID NO: 30

Вищеописані послідовності були модифіковані в ході експериментів шляхом додавання His-Tag з послідовністю LEHHHHHH (SEQ ID NO: 31).

Як можна бачити з Фіг.7,46-Н4 має чудове зв'язує спорідненість з ED-B (кД=189 нМ); 46-А5 і 52-D10 не мають зв'язуючої активності, тоді як інші модифіковані убиквитиновие білки мають невелику зв'язуючу активність з ED-B по порівнянні з 46-Н4. Таким чином можна зробити висновок, що обидва мс номери у гетеродимерном варіанті потрібні для високоаффинного зв'язування з мішенню; обидва мономеру виявляють одновалентних зв'язування з мішенню.

Гетеродимер модифікованого убіквітину з високою активністю зв'язування з ED-B, названий 46Н9, ідентифікується такими замінами амінокислот у про(їх областях зв'язується домену в двох мономерах порівняно з мономерами убіквітину дикого типу:

у першому модулі (BDR1) (a, 4V, K6R, Q62P, K63H, Е64Р, S65T, T66L у другому модулі (с) K6M L8R, Q62M, K63N, Е64А, S65R, T66L

46Н4

у першому модулі (46Н9)(а) Q2G, F4V, K6R, Q62P, K63H, Е64Р, S65T, T66L у другому модулі (d) K6G, L8W, Q62T, K63Q, E64Q, S65T, T66R

52В3

у першому модулі (g) Q2R, F4P, K6Y, Q62P, K63P, E64F, S65A, T66R у другому модулі (46Н9) K6H, L8M, Q62K, K63P, E64I, S65A, Т66Е

52D10 (не зв'язується з ED-B)

у першому модулі Q2V, F4C, K6R, Q62T, K63A, Е64Р, S65G, T66D

у другому модулі (46Н9) (е) K6H, L8M, Q62K, K63P, E64I, S65A, Т66Е

46А5 (не зв'язується з ED-B)

у першому модулі (46Н9)(а) Q2G, F4V, K6R, Q62P, K63H, Е64Р, S65T, T66L у другому модулі (b) K6L, L8M, Q62L, k63 A, E64F, S65A,

На Фіг.8 показано вирівнювання послідовності. Лінія 1: два мономеру убиквитинового білка дикого типу (1-я лінія) пов'язані з 12-аминокислотньгм лінкером SGGGGSGGGGIG, що починається в положенні 77 і закінчується в положенні 88; другий мономер з BDR2 починається в положенні 89 з метіоніном. Цей димерний убиквитиновий білок дикого типу вирівняний з гетеродимерним варіантом 46-Н9 модифікованого убіквітину (2-я лінія) з різними модифікаціями в першому і в другому мономерах, даючи дві ОСД. Обидві ОСД діють спільно в зв'язуванні мішені з-за одновалентного зв'язування з мішенню.

На Фіг.9 показано вирівнювання послідовності гетеродимерного варіанти 1041-D11 (1-я лінія) модифікованого убиквитЃ двома мономерами (положення 77 - 79; другий мономер починається з метіоніну в положенні 80), і заміна гліцину на аланін в останніх с-термінальних амінокислотах 2-го мономеру. Третя лінія показує "Убі-димер дт", як димеру убіквітин дикого типу; не показуючи линкерного вирівнювання (таким чином, другий мономер починається в положенні 77 з метіоніном). 4-я лінія показує "Убі-мономер дт", який є людським убиквитином дикого типу.

На Фіг.10 показаний залежить від концентрації ІФА зв'язування варіанти 1041-D11 гетеродимерного убіквітину з ED-B людини. Варіант 1041-D11 проявляє дуже високоаффинное зв'язування з ED-B (кД=6,9 нМ=6,9×10-9М). Закриті точки показують спорідненість зв'язування варіанти 1041-D11 гетеродимерного убіквітину з ED-B, що містить фрагмент фібронектину (названий 67В89-tO), порівняно з отсутст вієм зв'язування цього варіанту з негативним контролем (названим 6789-tO) (незафарбовані кола).

На Фіг.11 показані результати конкурентного, що залежить від концентрації ІФА зв'язування варіанти 1041-D11 гетеродимерного убіквітину з іммобілізованим ED-В, що містить фрагмент фібронектину (67В89), в присутності зростаючих кількостей вільного мішені. Варіант 1041-D11 гетеродимерного убіквітину проявляє про�ифицированного гетеродимерного убіквітину в аналізах взаємодій без міток з використанням Biacore®. Були проаналізовані різні концентрації цього варіанту гетеродимерного убіквітину (дивіться легенду на Фігурі: 0-200 нМ 1041-D11) для зв'язування з ED-B, що містить фрагмент фібронектину (названий 67 В89), іммобілізованих на чіпі SA (Biacore). Аналіз кривих асоціації і дисоціації дав значення кД 1 нМ (1×10-9М) і показник koff 7,7×10-4з-1, який показує тривалий час напіврозпаду комплексу 1041-D11 і ED-B.

На Фіг.13 показано зв'язування варіанти 1041-D11 гетеродимерного убіквітину з ED-B в залежній від концентрації ІФА при одночасному аналізі сироваткової стабільності зв'язуючої активності. Показано різні умови, такі як попередня інкубація протягом 1 години при 37°З цього варіанту в сироватці миші або щури і в PBST як контролі. Значення кД знаходяться в інтервалі від 10 до 20 нМ. Таким чином, можна зробити висновок, що на зв'язування гетеродимера 1041-D11 з ED-сироватка крові впливає незначно.

На Фіг.14 показаний аналіз формування комплексу варіанти 1041-D11 гетеродимерного убіквітину з фрагментами фібронектину за рахунок СО-ЖХВР.

На Фіг.14А показано формування комплексу 1041-D11 з ED-B. Три хроматограмми ЖХВР накладені один на одного: синій пік з часом утримання 21,651 хв проись 1041-D11 і 67В89 дає червоний пік з часом утримання 21,407 хв після З-ЖХВР. Зсув піку 1041-D11 на менший час утримання, а також зникнення піку 67В89 вказує на формування комплексу 1041-D11 і розчинної ED-B.

На Фіг.14 показано накладення трьох хроматограмм З-ЖХВР 1041-D11 (синій, 21,944 хв), фрагмент фібронектину 6789 без ED-B (чорний, 26,289 хв) і суміш 1041-D11 і 6789 (червона лінія з піками в 21,929 хв і 26,289 хв). Майже не спостерігається зсув піку 1041-D11. Цей факт разом з відсутністю зникнення піку 6789 вказує на незначне зв'язування вільного фрагмента фібронектину 6789 ED-B.

На Фіг.15 показано зв'язування варіанти 1041-D11 гетеродимерного убіквітину з клітинами клітинної культури.

На Фіг.15А показано зв'язування варіанти 1041-D11 гетеродимерного убіквітину на фибробластних клітинах (Wi38) ембріонального легені людини, які були зафіксовані. Перша колонка на Фіг.15 показує контроль, що використовує анти-ED-B антитіла, друга колонка показує інкубацію цього варіанту при концентрації білка 58,7 нМ, третя колонка показує десятикратно більш високу концентрацію білка 1041-D11 (587 нМ), четверта колонка є негативним контролем з фізіологічним розчином з фосфатним буфером. У першому ряду фибробластние клітини Wi38 людини показані у фазовому контрасті; другий ряд показива41-D11 зв'язується з Wi38 з високою специфічністю до ED-B, містить позаклітинний матрикс.Був виконаний контрольний аналіз з використанням клітин NHDF, які експресують низький рівень ED-B (дані не показані). Ці варіанти не зв'язуються з цими клітинами.

На Фіг.15В показано зв'язування на фибробластних клітинах (Wi38) життєздатного ембріонального легені людини. Негативні контрольні клітини TnnaNHDF є первинними нормальними фибробластними клітинами, які експресують низькі рівні EDB-фібронектину. Перша і третя лінії показують цей варіант при різній концентрації білка і негативний контроль. Друга і четверта лінії показують інкубацію контролю з використанням антитіл до EDB. Перші 2 лінії показують варіант і позитивний контроль на клітинній лінії Wi38. Третя і четверта лінії показують інкубацію NHDF - клітин. Можна бачити, що варіант 1041-D11 зв'язується з Wi38 з високою специфічністю до ED-B, що містить позаклітинний матрикс.

На Фіг.15С показано зв'язування на фіксованих мьппиних клітинах Balb 3Т3. Були перевірені три концентрації білка (1,10, 50 нМ) цього варіанту. Перший ряд показує цей варіант (SPVF-28-1041-41 1-TsX9) на клітинах, другий ряд показує позитивний контроль (антитіла до Fv28-EDB-15), третій ряд показує ін, �варіант 1041-D11 зв'язується з мьшшними клітинами Balb ЗТЗ з високою специфічністю до ED-B, що містить позаклітинний матрикс.

На Фіг.15D показано зв'язування на фіксованих мьппиних клітинах ST-2. Були перевірені три різних концентрації білка (1,10, 50 нМ) цього варіанту. Перший ряд показує варіант (SPVF-28-1041-411-TsX9) на клітинах, другий ряд показує позитивний контроль (антитіла до Fv28-EDB), третій ряд показує інкубацію з негативним контролем (UB2_TsS9; модифікований убіквітин, відповідний SEQ ID NO: 1). Можна бачити, що варіант 1041-D11 гетеродимерного убіквітину зв'язується з мишачими клітинами Balb ST-2 з високою специфічністю до ED-B, що містить позаклітинний матрикс.

На Фіг.16 А показана специфічність варіанти 1041-D11 гетеродимерного убіквітину з мішенню в зрізах тканин ссавців. Були оцінені пухлинні тканини F9 з семи проб. Імуногістохімія з різними концентраціями від 10 нМ до 100 нМ варіанти 1041-D11 гетеродимерного убіквітину призвела до специфічного васкулярному фарбування ED-B на пухлинах F9 від мишей. ED-B є високо специфічним маркером для пухлинної судинної мережі. Білок-мішень ED-B розташований на аблюминальной стороні судин. Варіант 1041-D11 специфічно декорує судинну сі перевірені 48 тканин; ніякого неспецифічного фарбування в будь-який з 48 тканин у релевантній панелі FDA не спостерігалося.

На Фіг.16 У показана акумуляція 1041-D11 в пухлинної тканини в порівнянні з убиквитином дикого типу (на цій Фігурі, Ub 2 (NCP2). Пухлинні тканини F9 проаналізували на присутність 1041-D11 і убіквітин дикого типу в різні моменти часу між 30 хв і 16 год. Найбільша акумуляція 1041-D11 в пухлинної тканини спостерігалась через 30 хв і 16 год після введення, тоді як акумуляція убіквітину дикого типу в пухлинних тканинах F9 була низькою. Цей варіант містить у пухлинах, які експресують ED-B, порівняно з убиквитином дикого типу. Це є доказом спрямованості 1041-D11 на пухлинні тканини. Крім того, ставлення пухлина-кров 1041-D11 в моделі раку чітко демонструє in vivo активність варіанти 1041-D11 у тварин (дані не показані).

На Фіг.17 показана висока селективність та специфічність складеного білка 1041-D11-TNF-альфа для ED-B.

Фіг.17А і 17В: Индуцирующая апоптоз активність TNF-альфа із загального білка 1041-D11-TNF-альфа була перевірена в клітинному аналізі (клітини L929). Ці Фігури чітко показують, що складовою білок 1041-D11-TNF-альфа (Фіг.17В) є таким активним, як вільний TNF-альфа (Фіг.17В) в клітинній культуѰ з мішенню ED-B. Домен 67В89 фібронектину ED-B людини зв'язується з явним значенням кД 1,8 нМ з варіантом 1041-D11 (зафарбовані кола), показуючи високу спорідненість для цієї мішені. Людський фібронектин без домену ED-B (h6789) не зв'язується варіантом 1041-D11-TNF-альфа (незафарбовані кола).

На Фіг.17D+E показаний аналіз зв'язування складеного білка 1041-D11-TNF-альфа на основі модифікованого убіквітину з ED-B за допомогою аналізів Biacore. Результати демонструють високу спорідненість складеного білка 1041-D11-TNF-альфа з значенням кД=1,13 нМ.

На Фіг.17F показана висока специфічність зв'язування, що спостерігалася з варіантом 1041-D11, в клітинній культурі, яка зберігається, коли 1041-D11 об'єднаний з TNF-альфа. Цей складовою білок специфічно зв'язується з экспрессирующими клітинами EDB. Таким чином, складовою білок 1041-D11-TNF-альфа зв'язується з дуже високою спорідненістю і специфічністю з мішенню ED-B (мішень(+)"). У сироватці без ED-B (мішень(-)"), перехресної реакції не спостерігається.

На Фіг.18 показано відносний ріст пухлини in vivo під час лікування мишей протягом 7 діб варіантом 1041-D11, об'єднаним з TNF-альфа в поєднанні з мелфа-ланом. Дані чітко показують, що варіант 1041-D11-TNF-альфа в поєднанні з цитостатичних агентом мелфаланом зменшує �нетика росту пухлини протягом 7 діб після лікування показує ефективне скорочення пухлин варіантом 1041-D11-mTNFa. Це є чітким доказом ефективності лікування пухлин складовим білком 1041-D11-TNF-альфа в поєднанні з мелфаланом. ED-B ідентичний у декількох видах ссавців, включаючи мишей і людини, і, таким чином, ці результати прогнозують дію варіанти 1041-D11-TNF-альфа для людей.

ПРИКЛАДИ

Наступні Приклади представлені для подальшої ілюстрації винаходу. Винахід, зокрема, продемонстровано по відношенню до модифікації убіквітину в якості прикладу. Винахід, однак, цим не обмежена, і наступні Приклади просто показують здійсненність винаходу на практиці на основі вищенаведеного опису. Для повного розкриття винаходу також робиться посилання на публікації, згадані в даній заявці та в додатку, які все включена в повному обсязі в дану заявку шляхом посилання.

Приклад 1. Ідентифікація гетеродимерних білків, що з ED-B, на основі модифікованих убиквитинових білків

Конструювання і клонування бібліотеки

Якщо не вказано інше, використовувалися добре відомі рекомбінантні генетичні способи, які описані, наприклад, у публікації Сэмбрука та ін. (Sambrook et al). Неспецифічна бібліотека гетеродимеров людини вибраних положень амінокислот.Модифіковані амінокислоти, які були заміщені триплетами NNK, включали щонайменше 3 амінокислоти, обирані з положень 2, 4, 6, 8, 62, 63, 64, 65, 66, 68 у проксимальному (першому) мономере убіквітину, і щонайменше 3 амінокислоти, обирані з положень 2,4, 6, 8, 62, 63, 64, 65, 66, 68 в дистальному (другому) мономере убіквітину. Обидва мономеру убіквітину були генетично пов'язані (голова до хвоста) лінкером гліцин/серин щонайменше з послідовністю GIG або лінкером гліцин/серин щонайменше з послідовністю SGGGG, наприклад GIG, SGGGG, SGGGGIG, SGGGGSGGGGIG (SEQ ID NO: 32) або SGGGGSGGGG, але можливий будь-який інший лінкер.

Вибір фагового дисплею TAT

Бібліотека гетеродимерного убіквітину була збагачена щодо використання мішені, наприклад, фагового дисплею ТАТ як системи вибору. Можуть бути використані інші способи вибору, відомі в даній області. Мішень може бути іммобілізована неспецифічно на що поверхнях білка або через биотинилированние залишки, які були ковалентно з'єднані з білком. Бажана іммобілізація за допомогою біотину на гранулах стрептавидина або смужках нейтравидина. Фаги, що зв'язуються з мішенню, вибирають або в розчині, або на іммобілізованої мішені; наприклад, биотиЃтем элюирования фагів, пов'язаних з матриксом. В кожному циклі після інкубації мішені гранули відокремлювали від розчину магнітним способом і промивали кілька разів. У першому циклі вибору биотинилированная мішень була іммобілізована на смужках нейтравидина, тоді як в циклах 2-4 виконували вибори в розчині, після чого слідувала іммобілізація комплексів мішень-фаг на покритих стрептавидином гранулах Dynabeads® (компанія Invitrogen). Після промивання у перших двох циклах вибору фаги зв'язується з мішенню модифікованого убіквітину вивільняли шляхом элюирования кислим розчином. У циклах вибору 3 і 4 элюирование фагів здійснювали шляхом конкурентного элюирования з надлишковою мішенню. Элюированние фаги були реамплифицировани. Для напряму специфічності сполучних під час вибору можна включити білок, схожий з мішенню.

Альтернативно вибору фагового дисплею ТАТ: виборрибосомного дисплея

Бібліотека убіквітину була збагачена щодо використання мішені, наприклад, рибосомним дисплеєм в якості системи вибору (Занд та ін. (Zahnd et al.), 2007), Охасі та ін. (Ohashi et al.), 2007). Можуть бути використані інші способи вибору, відомі в даній області. Мішень була биотинилирована згідно стандартних способів і иммооми, мРНК і метушні кающий убиквитиновий поліпептид, були ассемблировани з використанням набору PURExpressTMIn Vitro для синтезу білка (NEB). Були виконані два первинних циклу вибору, в яких інкубували трійкові комплекси, після чого вили виконані два подібних циклу вибору. В кожному циклі після інкубації мішені гранули відокремлювали від розчину магнітним способом і промивали буфером рибосомному дисплея з підвищеною ретельністю. Після промивання у перших двох циклах вибору гранули знову відокремлювали від розчину магнітним способом, і молекул мРНК модифікованого убіквітину, що з мішенню, звільнили від рибосом шляхом додавання 50 мМ ЕДТА. У циклах 3 і 4 вибору элюирование мРНК здійснювали конкурентним элюированием з надлишковою мішенню (Липовсек і Плактун (Lipovsek and Pluckthun), 2004). Після кожного циклу виконували очищення РНК і синтез кДНК з використанням набору "RNeasy MinElute Cleanup Kit" (компанія Qiagen, Німеччина), набору "Turbo DNA-free Kit" (компанія Applied Biosystems, США) і зворотної транскриптази транскриптора (компанія Roche, Німеччина).

Клонування збагачених пулів

Після четвертого циклу вибору синтезована кДНК була амплифицирована допомогою ПЛР через праймери F1

(GGAGACCACAACGGTTTCCCTCTAGAAATAATTTTGTTTAACTTTAAGAAGGAG Xhol (компанія Promega, США) і лигирована в экспрессирующий вектор рЕТ-20b(+) (компанія Merck, Німеччина) через сумісні липкі кінці.

Аналіз збігів клонованих колоній

Після трансформації в клітини NovaBlue(DE3) (компанія Merck, Німеччина) резистентні до ампіциліну клоновані колонії вирощували протягом 6 год при 37°С в 200 мкл середовища СОБ AG (середовище СОБ, що містить 100 мкг/мл ампіциліну і 20 г/л глюкози), експресія модифікованого убіквітину, що зв'язується з ED-B, була досягнута шляхом культивування протягом 16 год при 37°С в 96-лункових глибоких планшетах (компанія Genetix, Великобританія) з використанням 500 мкл автоиндукционной середовища ZYM-5052 (Штудиер (Studier), 2005). Клітини зібрали шляхом центрифугування протягом 15 хв при 4°С і 3600 g і потім лизирували шляхом інкубації протягом 30 хв при 37°С з 300 мкл буфера лізису на лунку, що містить 0,2× BugBuster® (компанія Merck, Німеччина), 0,3 мг/мл лізоциму (компанія VWR, Німеччина) 0,2 мМ фенилметилсульфонилфторида (компанія Roth, Німеччина), 3 мМ MgCl2і 0,2 од./мл бензонази (компанія VWR, Німеччина) в 50 мМ NaH2PO4, 300 мМ NaCl, рН 8. Після центрифугування протягом 30 хв при 4°С і 3600 g отримані супернатанти піддали скринінгу шляхом ІФА, використовуючи планшети Nunc MediSorp (компанія Thermo Fisher Scientific, США), покритиерующего реагенту використовували TMB-Plus (компанія Biotrend, Німеччина), і жовтий колір отримали, використовуючи 50 мкл/лунка 0,2 М розчину H2SO4, виміряли в спектрофотометрі для читання планшетів на 450 нм проти 620 нм.

Зазвичай виконували кілька, наприклад, чотири циклу дисплея вибору проти ED-B. У двох останніх циклах вибору зв'язують молекули элюировали з надлишком вільного ED-B. Були ідентифіковані, крім інших, такі зв'язують ED-B варіанти.

Послідовність 46Н9

MGIVVRTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIWAGKQLEDGRTLSD YNIPHPTLLHLVLRLRGGSGGGGSGGGGIGMQIFVHTMTGKTITLEVEPSDTIENVKA KIQDKEGIPPDQQRLIWAGKQLEDGRTLSDYNIKPIAELHLVLRLRGG (SEQ ID NO: 6)

Послідовність 9Е12

MRIPVYTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIWAGKQLEDGRTLSD YNIPPFARLHLVLRLRGGSGGGGSGGGGIGMQIFVMTRTGKTITLEVEPSDTIENVKA KIQDKEGIPPDQQRLIWAGKQLEDGRTLSDYNIMNARLLHLVLRLRGG (SEQ ID NO: 7)

Послідовність 22D1

MLILVRTLTDKTITLEVEPSDTIGNVKLAKIQDKEGIPPDQQRLIWAGKQLEDGRTLSD YNISVGAMLHLVLRLRGGSGGGGSGGGGIGMQIFVLTWTGKTITLEVEPSDTIENVKA KIQDKEGIPPDQQRLIWAGKQLEDGRTLSD YNIRRLPPLHLVLRLRGG (SEQ ID NO: 8)

Вирівнювання послідовності мономеру убіквітину дикого типу (Убі-мономер дт) з димером убіквітину дикого типу (Убі-димер дт) і убиквитиновим білком (Ub 2-TsX на Фіг.9 з заміною в положенні 45 кожного мономеру і з двома заміщеннями в З-закінчення) з гетеродимерним варіантом 1041-D11 модифікованого убіквітину показано на Фіг.9. В Ub 2-TsX заміщення в З-закінчення (GG на АА) мономеру підвищують стабільність в сироватці, посколравнению з убиквитином з цими заміщеннями в З-закінчення майже ідентична.

Модифіковані убиквитини з чудовою активністю зв'язування з ED-B, зазначені як 1041-D11 (показані на Фіг.9; SEQ ID NO: 36) або 1045-D10, ідентифікуються за наступним замін амінокислот порівняно з диким типом: у першому модулі: K6W, L8W, K63R, E64K, S65F, Т66Р; у другому модулі: K6T, L8Q, Q62W, K63S, E64N, S65W, Т66Е; за вибором Q2R (у варіанті 1041-D11, але не у варіанті 1045-D10).Слушними переважними линкерами для цього складеного білка є такі з SEQ ID NO: 32 або послідовністю GIG. Однак є багато відомих линкеров, які можна використовувати замість їх.

В якості ще одного кращого прикладу білок представлений наступною послідовністю, де ХХХХ може бути будь амінокислотою (SEQ ID NO: 47). Як лінкера тут використовували SGGGGSGGGGIG (виділено курсивом). При цьому розуміється, що здійсненними альтернативами є інший вид линкеров або відсутність лінкера.

MTIWVHTLTGKTITLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIWAGKQLEDGRTLSDYNINFKLSLHLVLRLRGGSGGGGSGGGGIG

MQIFVXTXTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIWAGKQLEDGRTLSDYNINXXXXXLHLVLRLRGG

Консенсусні послідовності прикладів білків з цими послідовностями показані на Фіг.2.

Приклад 2. Отримання складових білків з варіантів модифікованого убіквітину, що зв'язують ED-B, TNF-альфа людини (hTNFa)

Е варіанту 1041-D11, і мишачого або людського TNFa в E. coli. Аналіз загального білка включає: експресію і чистоту білка, відсутність потенціалу аггрегации, активність TNFa в клітинній культурі, спорідненість білка-мішені ED-B, селективність, специфічне зв'язування в клітинній культурі. Передумовою для експерименту на тваринах по індукції скорочення пухлини у мишей з пухлиною F9 є об'єднання з мишачим TNFa.

Етап 1: Отримання вектора для клонування складових білків (pETSUMO-TNFa)

pETSUMOadapt є модифікованим вектором pETSUMO (компанія Invitrogen), який модифікований шляхом вставки додаткового сайту множинного клонування (MCS). Починаючи з TNF-альфа, клонованого в pETSUMOadapt, були введені рестрикційні сайти для вставки варіантів модифікованого убіквітину, що зв'язують ED-B. Отриманий конструкт має структуру His6-SUMO-TNFa з наступною ДНК-послідовністю (SEQ ID NO: 11):

ATGGGCAGCAGCCATCATCATCATCATCACGGCAGCGGCCTGGTGCCGCGCGGC

AGCGCTAGCATGTCGGACTCAGAAGTCAATCAAGAAGCTAAGCCAGAGGTGAAG

CCAGAAGTCAAGCCTGAGACTCACATCAATTTAAAGGTGTCCGATGGATCTTCAG

AGATCTTCTTCAAGATCAAAAAGACCACTCCTttaagaaggctgatggaagcgti

CGCTAAAAGACAGGGTAAGGAAATGGACTCCTTAAGATTCTTGTACGACGGTAT

TAGAATTCAAGCTGATCAGACCCCTGAAGATTTGGACATGGAGGATAACGATAT

TATTGAGGCTCACAGAGAACAGATTGGTGGTGTGCGTAGCAGCAGCCGTACCCC

GAGCGATAAACCGGTGGCGC ATGTGGTGGCGAATCCGC AGGCGGAAGGCC

AGCTGCAGTGGCTGAACCGTCGTGCGAATGCGCTGCTGGCCAACGGCGTGGAAC

TGCGTGATAATCAGCTGGTTAGGCGCGGAAGCGAAACCGTGGTAT

GAACCGATTTATCTGGGCGGCGTGTTTCAGCTGGAAAAAGGCGATCGTCTGAGC

GCGGAAATTAACCGTCCGGATTATCTGGATTTTGCGGAAAGCGGCCAGGTGTATT

TTGGCATTATTGCGCTGTAATAA

Ця послідовність TNF-альфа була амплифицирована допомогою ПЛР шляхом введення сайту BamHI - та сайту XhoI. Використані праймери:

SUMO-EDB-TNFa-rw (SEQ ID NO: 12): TTT TTT GGA ТССGTG CGTAGCAGC AGC

SUMO-EDB-TNFa-rev (SEQ ID NO: 13): CTT GTC TCT CGA GGC GGC CGCTTA TTAC

Праймер rw (прямий) (SEQ ID NO: 12) розпізнає перші 15 пар підстав TNFa (підкреслена область) і має BamHI-послідовність (виділено жирним шрифтом). Праймер rev (зворотний) (SEQ ID NO: 13) містить останню пару підстав TNFa, терминирующие кодони (підкреслені) та рестрикційний сайт Xhol (виділено жирним шрифтом).

Суміш для реакції ПЛР ПІР икл):

84,5 мкл Н2Про; 10 мкл 10× Pwo буфер+Mg; 2 мкл 10 мМ дезоксинуклеозидтрифосфата (=200 мкМ); по 0,5 мкл 100 мкМ праймерів прямого/зворотного (=кожен 0,5 мкМ); 2 мкл ДНК (=0,25 мкг); 0,5 мкл полімерази Pwo (=2,5 Од.; компанія Roche)

ПЛР-програма:

3 хв 94°С, 30 С 94°С, 30 С 60°С, 2 хв 72°С (2-4 етапи: 30 циклів), 5 хв 72°С, після 4°С, після очищення продукту ПЛР за допомогою набору Qiagen-MinElute (элюирование в 10 мкл ЕВ). Продукт ПЛР ввели в MCS вектора pETSUMOadapt допомогою BamHI-XhoI-рестрикції і лігування.

Суміш для рестрикції (100 мкл):

Вектор: 83 мкл Н2Про; 10 мкл 10× буфера NE 3; 1 мкл мкл Н2Про; 10 мкл 10× буфера NE 3; 1 мкл 100× BSA; 3 мкл BamHI (=30 Од.; NEB), 1,5 мкл Xhol (=30 Од.; NEB); 8 мкл вставки; інкубація протягом 3 год при 37°С.

Відділення рестрикції в 1% агарозному гелі (100 В цикл 60 хв); відрізання фрагмента вектора (5659 пар основ) і вставка (491 пара підстав); очищення з допомогою набору Qiagen для екстракції гелю (элюирование в 30 мкл ЕВ).

Лігування (20 мкл"):

15,2 мкл Н2Про; 2 мкл 10× Т4-ДНК лигазного буфера; 2,26 мкл вектора (200 нг); 0,54 мкл вставки (40 нг) інкубація 5 хв при 65°С; охолодження до 16°С; додавання 1 мкл Т4-ДНК-лігази (=3 Од.; NEB); інкубація 6 год при 16°С.

NaAc/ізопропанол-осадження: суміш для лігування (20 мкл)+2,2 мкл 3М NaAc (рН 5,0)+22,2 мкл ізопропанолу; 30 хв при -20°С; 15 хв при 4°С 13000 об/хв;

повторне суспендирование гранули в 500 мкл 70% EtOH; обертання; повторне суспен-дирование гранули в 10 мкл Н2О.

Трансформація:

Змішування електро-компетентних клітин Novablue(DE3) (40 мкл-аликвота) з 10 мкл продукту лігування; перенесення в кювету ОД см для электрополяции; вібрація в елек-трополяторе (1,8 кВ, 50 мкФ, 100 Ом); розчин для інкубації з 1 мл SOC-середовища 45 хв при 37°С 220 об/хв; 100 мкл на LB-планшеті з канаміцином; інкубація протягом ночі при 37°С.

Етап 2: Клонування EDB-складових білків на основі модифікований� TNFa, представляє інтерес послідовність на основі модифікованого убіквітину, що зв'язує EDB, ампліфікували з pET20b-вектора за допомогою ПЛР; ввели рестрикційні сайти Bsal і BamHI. Цей спосіб підходить для мономерних і димеризованих варіантів, що зв'язують EDB, на основі модифікованого убіквітину. Праймер для мономерного ДТ-Убіквітину (Wubi):

Прямий лінкер SUMO-EDB-WUBI (SEQ ID NO: 14):: GTT CCA AGG TCT CAT GGTATG CAG АТС TTC GTG

Зворотний лінкер SUMO-EDB (SEQ ID NO: 15):: GTG GTG GGA ТСС ACC GCC ACC ACC AGAACC GCC ACG CAG ACG

Прямий праймер (SEQ ID NO: 14) розпізнає перші 15 пар підстав модифікованого убіквітину (підкреслена область) і має Bsal-послідовність (виділено жирним шрифтом). Зворотний праймер (SEQ ID NO: 15) розпізнає останні 15 пар підстав модифікованого убіквітину і вставляє амінокислотний лінкер (послідовність SGGGG) і BamHI-рестрикционньш сайт (виділено жирним шрифтом). Для кожного варіанта на основі модифікованого убіквітину викорис зовали специфічний прямий праймер. Праймери для мономерних зв'язують EDB варіантів на основі модифікованого убіквітину 1Н4, 5Е1 і 4В10:

1Н4 (MWIKV...): праймер (8иМО-ЕБВ-1Н4-прямий) (SEQ ID NO: 16): GTT CCA AGG TCT CAT GGTATG TGG АТС AAG GTG

4B10 (MLILV): праймер (SUMO-EDB-4B10-npflMoft) (SEQ ID NO: 17): GTT CCA AGG TCT CAT �ий праймер використовували для всіх мономерних варіантів на основі модифікованого убіквітину. Зворотний праймер для димеризованих варіантів на основі модифікованого убіквітину:

Димер-t0a-зворотний (SEQ ID NO: 19): GTG GTG GGA ТСС ACC GCC ACC ACC AGAACC ACC ACG TAA ACG

Прямий праймер для клонування димеризованих ДТ-убиквитинов (WubiHubi) і для димеризованих зв'язують EDB варіантів на основі модифікованого убіквітину:

WT (MQIFV...) праймер (SUMO-EDB-WUBI-прямий) (SEQ ID NO: 20): GTT CCA AGG TCT CAT GGTATG CAG АТС TTC GTG

(Примітка: прямий праймер для димерного ДТ-убіквітину ідентичний прямим праймер для мономерного ДТ-убіквітину.)

9Е12 (MRIPV...): праймер (9ЕШ0а-прямий) (SEQ ID NO: 21): GTT CCA AGG TCT CAT GGTATG CGTATC CCTGTG

24H12 (MVIKV...): праймер (24Н12-Юа-прямий) (SEQ ID NO: 22):GTT CCA AGG TCT CAT GGTATG GTT АТС AAG GTG

15G7 (MEIGV...): праймер (15G7-t0a-np*Moft) (SEQ ID NO: 23): GTT CCA AGG TCT CAT GGTATG GAG АТС GGT GTG

22D1 (MLILV...): праймер (2201-Юа-прямий) (SEQ ID NO: 24): GTT CCA AGG TCT CAT GGTATG CTT АТС TTG GTG

ПЛР-суміш (100 мкл):

84,5 мкл Н2Про; 10 мкл 1 Ох Pwo-буфер+Mg; 2 мкл 10 мМ дезоксинуклеозидтрифосфата (=200 мкМ); по 0,5 мкл 100 мкМ праймера прямого/зворотного (=je 0,5 мкМ); 2 мкл ДНК (залежить від варіанту); 0.5 мкл Pwo-полімерази (=2,5 Од.; компанія Roche)

ПЛР-програма;

1. Змин94°С

2. 30 с94°С

3. 30 с60°С

4. 2 хв 72°С (2-4 етапи: 30 циклів)

5. 5 хв 72°С, після 4°С

Очищення ПЛР-продуктів в агарозному гелі, відрізання необхідної�икции (в pETSUMO-TNFa)

Рестрикція (100 мкл): 75 мкл Н2Про; 10 мкл 10х буфер NEB 3; 1 мкл ЮОх бичачого сироваткового альбуміну (БСА); 3 мкл Bsal (=30 Од.; NEB); 8 мкл ДНК (вектор або ПЛР-продукт) інкубація 2 год 50°С, 10 хв 65°С, додавання 3 мкл BamHI (=30 Од.; NEB), 2 год 37°З відділення рестрикції в 1% агарозному гелі; відрізання фрагмента вектора і вставка; очищення з допомогою набору Qiagen для екстракції гелю (элюирование в 30 мкл ЕВ).

Дотування (20 мкл):

12,5 мкл Н2Про; 2 мкл 10х Т4-ДНК лигазний буфер; 5 мкл вектор (66 нг); 0,5 мкл вставка (варіабельна), інкубація 5 хв 65°С; охолодження до 16°С; додавання 1 мкл Т4-ДНК-лігази (=3 Од.; NEB); інкубація 16 год 16°С

Осадження NaAc/ізопропанол (дивіться Етап 1)

Трансформація в электрокомпетентньгх клітинах Novablue(DE3), як сказано вище. Результатом є наступний конструкт злиття: EDB - модифікований убіквітин і TNFa у pETSUMOadapt з der His6-SUMO - модифікований убіквітин-SGGGG-TNFa (359 амінокислот з мономерним модифікованим убиквитином, 447 амінокислот з димерним модифікованим убиквитином)

Приклад 3: Експресія і очищення складових білків на основі убіквітину-Т№-альфа

Аналіз ДНК-послідовності показав правильність складових послідовностей білків SUMO-TNFa. Для експресії варіантів клони культивировалия 200 про/хв і 37°С до оптичної щільності при 600 нм (OD600) 0,5. Експресію индуцировали шляхом додавання IPTG (кінцева концентрація 1 мМ). Культивування продовжували протягом 4 годин при 30°С і 200 об/хв. Клітини бактерій зібрали центрифугуванням при 4°С, 6000× g протягом 20 хв. Клітинну гранулу суспендованих в 30 мл буфера NPI-20, включає бензоназу і лізоцим. Клітини деструктировали ультразвуком (3×20 секунд) на льоду. Супернатант, що містить розчинні білки, був отриманий після центрифугування суспензії: при 4°С і 40000× g протягом 30 хв. Обидва білка були очищені афінної хроматографією при кімнатній температурі. Одна колонка Ni-агароза (5 мл, компанія GE Healthcare) була урівноважена 50 мл NPI-20. Супернатант, що містить ці розчинні білки, був доданий в колонку, за чим послідував етап промивання NPI-20. Зв'язаний білок элюировали з лінійним градієнтом до 50% NPI-500 в 100 мл Фракції аналізували денатурирующим електрофорезом у поліакриламідному гелі щодо їх чистоти. Відповідні фракції об'єднували і подавали в гель-фільтраційну колонку (Superdex 75, 1,6×60 см, компанія GE Healthcare), врівноважену SUMO-гидролазним буфером для розщеплення (50 мМ Трис, 300 мМ NaCl, рН 8,0) з витратою 1 мл/хв.

Реакцію розщеплення виконували згідно інструкції виробника (компанія Invitrogen). Після расѻись з колонкою, а правильний складовою білок проходив колонку (без His-мітки). Чистоту білків підтвердили аналізом рідинної хроматографією високого дозволу і гель-електрофорезом. Правильність молекулярної маси тримера (за допомогою TNFa) підтвердили, використовуючи аналітичний SEC-аналіз (10/30 Superdex G75, компанія GE Healthcare).

Приклад 4: Аналіз зв'язування варіантів, що зв'язують ED-B, на основі модифікованого убіквітину з ED-B людини

Приклад 4А. Аналіз зв'язування варіантів, що зв'язують ED-B, на основі модифікованого убіквітину шляхом ІФА, що залежить від концентрації.

Зв'язування варіантів на основі убіквітину з ED-B людини аналізували шляхом ІФА, що залежить від концентрації. Збільшення кількості очищеного білка наносили на планшети NUNC-medisorp, вкриті ED-B людину, ВСА і клітинним фибронектином (cFN). Антигенна покриття 50 мкл (10 мкг/мл) на лунку виконали при 4°С протягом ночі. Після промивання планшетів фосфатно-сольовим буфером ФСБ), 0,1% Tween-20 рН 7,4 (ФСБТ) лунки блокували, використовуючи блокуючий розчин (ФСБ рН 7,4; 3% БСА; 0,5% Tween-20) при 37°С протягом 2 ч. Лунки знову три рази промили ФСБТ. Різні концентрації білка, що зв'язує ED-B на основі модифікованого убіквітину потім інкубували в лунках при ко�-D11). Після промивання лунок ФСБТ завдали кон'югат перокси-дази хрону фрагмента анти-Ubi fab (AbyD) у відповідному розведенні (наприклад, 1:2000 або 1:6500) в ФСБТ. Планшет промили три рази 300 мкл буфера ФСБТ на лунку. У кожну лунку додали 50 мкл розчину субстрату ТМВ (компанія KEM-EN-Тес) і інкубували протягом 15 хв. Реакцію припинили шляхом додавання 50 мкл 0,2 М H2SO4на лунку. Планшети ІФА зчитували, використовуючи пристрій для читання ІФА TECAN Sunrise. Фотометричні вимірювання спектральною поглинальною спо собности виконали на 450 нм, використовуючи 620 нм в якості контрольної довжини хвилі. На Фіг.1 чітко показано специфічне зв'язування 1Н4 з ED-B з істинним кД-значенням 11 нМ. Варіант 5Е1 показав справжнє кД-значення 7,7 мкМ і 4В10 280 нМ відповідно. Фіг.10 показує дуже високоаффинное зв'язування варіанти 104] D11 з ED-B (кД=6,9 нМ). Таким чином, тільки трохи модифікацій (до 8 замеще ний у кожному мономере) в убиквитине дикого типу призводять до дуже високоаффинному зв'язування з ED-B.

Приклад 4 Ст. Аналіз зв'язування варіантів, що зв'язують ED-B, на основі модифікованого убіквітину шляхом конкурентного ІФА, що залежить від концентрації.

Був виконаний конкурентний, залежний від концентрації ІФА, для аналізу связивЃвеличивающихся кількостей вільного мішені. Умови ІФА були як описано, наприклад, для Прикладу 5А, за тим винятком ням, що білок 1041-D11 був попередньо инкубирован з ED-B (67В89) (0 -10 мкМ мкМ) або також з негативним контролем 6789 (0 мкМ-10 мкМ) протягом 1 год і потім цю суміш з мішенню 67В89 помістили на планшет Medisorp; після цього цей варіант булл детектирован відповідним антитілом (анти-Убіквітин-Fab-пероксидаза хрону; розведення 1:6500). На Фіг.11 показано, що варіант 1041-D11 має дуже високоаффинное зв'язування з ED-B (IC50=140 нМ). Результат, показаний на Фіг.10 підтверджений; тільки трохи модифікацій (до 8 заміщень в кожній мономере) в убиквитине дикого типу призводять до дуже високоаффинному зв'язування з ED-B.

Приклад 4С. Аналіз зв'язування варіантів, що зв'язують ED-B, на основі модифікованого убіквітину шляхом конкурентного ІФА, що залежить від концентрації, з одночасним аналізом стабільності зв'язуючої активності в сироватці.

ІФА виконали, використовуючи способи, добре відомі в цій галузі, які описані вище (Приклад 5А і 5B). ED-B (тут названий 67В89) нанесли на мікро-трубки планшети, цей варіант пов'язали з ED-B і детектировали антитілом, специфічним до убиквитину (анти-Ubi-Fab-пероксидаза хрону). Варіант в цьому аналізі иние крути); варіант інкубували в сироватці щурів протягом протягом 1 год при 37°С (на Фіг.13 червоні кола), або варіант інкубували в ФСБ протягом 1 год при 37°С (на Фіг.13 чорні кола). Фіг.13 показує, що всі кД варіанти 1041-D11 становили від 10,3 нМ (ФСБ) до 20,74 нМ (в сироватці мишей).

Приклад 4D. Аналіз зв'язування варіантів, що зв'язують ED-B, на основі модифікованого убіквітину шляхом аналізів Biacore.

Були проаналізовані різні концентрації варіанти (наприклад, 0-200 нМ варіанти, переважно 1041-D11) для зв'язування з ED-B, що містить фрагмент фібронектину (названий 67В89), іммобілізованих на чіпі СМ5 (Biacore), використовуючи способи, відомі фахівцям в даній області. Отримані дані обробляли за допомогою програмного забезпечення BIAevaluation і 1:1 - Langmuir-підгонкою. Молекулярна маса варіанти 1041-D11 становила 1,0 нМ, як показано на Фіг.12. Кінетичні константи зв'язування склали kon=7,6×105; koff=7,7×10-4з-1. KDскладеного білка 1041-D11 - TNF-альфа склала 1,13 нМ, як показано на Фіг.17D. Кінетичні константи зв'язування склали kon=4,5×105M-1V-1; koff=5,0×10-4з-1.

Приклад 4Е. Аналіз формування комплексу варіантів, що зв'язують ED-B, на оѽки Tricorn Superdex 755/150 GL (компанія GE Healthcare) (обсяг=3 мл), кількість вводиться білка склало 50 мкл. Інші умови: буфер: 1× ФСБ, рН 7,3, витрати: 0,3 мл/хв, цикл: 45 хв (ін'єкція проби: через 15 хв). Умова: 0,72 нмоли білка 1041-D11+0,72 нмоли ED-B (тут названий 67В89 або негативного контролю 6789) інкубували протягом 1 год при кімнатній температурі; потім наносили на колонку для аналізу формування комплексу. На Фіг.14 тільки варіант показаний чорним, тільки мішень ED-B показана синім, зв'язування варіанту, що формує комплекс з ED-B, показано рожевим. Фіг.14А показує ED-B з цим варіантом; Фіг.14 показує варіант без ED-B. Ця Фігура показує, що варіант 1041-D11 формує комплекс з ED-B (67В89), але не формує комплексу з 6789.

Приклад 5: Біологічний аналіз TNF-альфа

Фізіологічну активність TNF-альфа злиттів, що зв'язують ED-B, на основі TNF-альфа-модифікованого убіквітину визначали, використовуючи аналіз L929 апоп-тоза (Флік та ін. (Flick et al), 1984 J. Immunol. Methods. 68:167-175). У цьому аналізу TNF-альфа ефективно стимулює смерть клітин в клітинах, сенсибілізованих актиномицином Д при значеннях ЕС50 в пикомолярном діапазоні.

Клітини повторно суспендованих в середовищі, що містить ФСБ і антибіотики. Клітинну суспензію в об'ємі 100 мкл з щільністю 3,5 х 105клітин/мл посеночи в інкубаторі з зволоженим CO2. Після цього культуральне середовище вилучили та додали 50 мкл середовища, що містить ФСБ, актиноміцин Д і антибіотики, в кожну лунку, після чого інкубували ще 30 хв. Після цього додали 50 мкл об'єктів, що перевіряються, злиттів, що зв'язують ED-B, на основі TNF-альфа-модифікованого убіквітину або, як контроль, рекомбінантного TNF-альфа людини у відповідному діапазоні концентрацій від 10-7до 10-18М. Після 48 год інкубації визначили метаболічну активність як запобіжний виживання клітин, використовуючи реагент WST-1 (компанія Roche).

Для кожного об'єкта, що перевіряється, були виконані щонайменше три незалежних експерименту, кожен з них три рази. Кожна перевірка складових білків, що зв'язують ED-B, на основі TNF-альфа-модифікованого убіквітину проходила паралельно з перевіркою діапазону дози рекомбінантного TNF-альфа людини, щоб отримати інформацію про варіабельність між аналізами.

Кількісна оцінка базується на значенні ЄС50, тобто, значення концентрації об'єкта, що перевіряється, сприяє виживанню половини клітин.

Таблиця 2
Злиття TNF-альфа-mubЗлиття mub® TNF-альфаВідповідний TNF-альфа
Wubi-TNF-альфа5,18±2,84 пМ7,97±12,18 пМ
Wubi-Hubi-TNF-альфа32,58±11,26 пМ5,02±3,70 пМ
SPWF-28_22-D1_ТNF-альфа26,15±14,41 пМ2,32±2,07 пМ
SPWF-28_24-H12_TNF-альфа0,78±0,24 пМ3,01±4,18 пМ
де: mub=зв'язування ED-B на основі модифікованого убіквітину.

Із злиття, зв'язує ED-B, на основі TNF-альфа-модифікованого убіквітину були проаналізовані один мономер убіквітину (Wubi) і три конструкта ді-міра убіквітину. В залежності від варіанту на основі модифікованого убіквітину, що зв'язує ED-B і сполученого з частиною TNF-альфа, пов'язана з TNF-альфа активність зростала (SPWF-28_24-H12_STNF-альфа) або спадала (SPWF-28_22-D1_TNF-альфа, Wubi-Hubi-TNF-альфа) приблизно на один порядок. Дивіться Фіг.17 з аналізу варіанту 1041-D11 TNF-альфа.

Приклад 6. Аналіз зв'язування варіантів убіквітину в пробах клітинної культ�их клітинних культур, включаючи нормальні фибробластние клітини ембріонального легені людини, що мають високі рівні експресії ED-B (клітини Wi38), клітинну лінію ембріонального фібробласту мишей (Balb 3Т3); лінію стромальних клітин, отриману з моноцитів/макрофагів (RAW264.7) кісткового мозку мишей (ST-2), клітини NHDF і мишачі фибробластние клітини (LM).

Варіант 1041-D11 (різні концентрації) або антитіло, специфічне до ED-B (500 нМ FV28 CH4/F1 1× ФСБ були інкубовані (1 год., 37°С) з клітинами Wi38 (60000 клітин/мл; з АТСС), після чого виконали фіксацію метанолом (5 хв, -20°С), блокування (5% хрону/ФСБ, 1 год); інкубацію з a-Strep-Tag-IgG кролика (отриманого від компанії GenScript А00875,1:500) протягом 1 год і інкубацію з a-rabbit-IgG*А1еха488-АК кролика (отриманого від компанії Invitrogen Al 1008,1:1000) протягом 1 ч. Ядра були пофарбовані DAPI. Перша колонка на Фіг.15А показує контроль, використовує антитіла kEDB, друга колонка показує інкубацію варіанту при концентрації білка 58,7 нМ, третя колонка показує вдесятеро більшу концентрацію білка 1041-D11 (587 нМ), четверта колонка показує негативний контроль з ФСБ. У першому ряду фибробластние клітини Wi38 людини показані у фазовому контрасті, другий ряд показує иммунофлуоресценцию і третій ряд показує фарбування DAPI. З этифичностью до ED-B, містить позаклітинний матрикс.Негативні контрольні клітини типу NHDF є первинними нормальними фибробластньгми клітинами, які експресують низькі рівні EDB-фібронектину (дані не показані). Ці варіанти не зв'язуються з цими клітинами.

На Фіг.15 показаний аналіз варіанти 1041-D11 на життєздатних клітинах Wi38. Негативні контрольні клітини типу NHDF є первинними нормальними фибробластними клітинами, які експресують низькі рівні EDB-фібронектину. Клітини помістили в слайди камери (NUNC, 60000 клітин/мл). Для аналізу потенціалу зв'язування клітини фіксували за допомогою 100% МеОН протягом 5 хв при -20°С. Для блокування неспецифічного зв'язування клітини інкубували з 5% кінської сироваткою протягом 1 год при 37°С. Клітини перевірили з варіантом 1041-D11, антитілом FV28 CH4/F1, специфічним до ED-B, в якості позитивного контролю або UB 2 в якості негативного контролю в різних концентраціях протягом 1 год при кімнатній температурі. Перевірку провели шляхом інкубації з a-Strep-Tag-IgG кролика (отриманого від компанії GenScript А00875,1:500) протягом 1 год інкубації з a-rabbit-IgG*Alexa488-AK кролика (отриманого від компанії Invitrogen Al 1008, 1:1000) протягом 1 ч. Ядра пофарбували DAPI. Перша і третя лінії на Фіг.15 пок�вають інкубацію контролю з використанням антитіл до EDB. Перші дві лінії показують варіант і позитивний контроль на клітинній лінії Wi3 8. Третя і четверта лінії показують інкубацію клітин NHDF. Зображення можна бачити, що варіант 1041-D11 зв'язується з життєздатними клітинами Wi38 з високою специфічністю до ED-B, що містить позаклітинний матрикс.Був виконаний контроль з використанням клітин NHDF, які не містять низький рівень EDB (дані не показані). Варіанти не зв'язуються з цими клітинами.

Подібні експерименти були виконані з використанням різних типів клітин, наприклад, Balb3T3 (АТСС, кат.№30-2002), Raw (Lonza, кат. №ВЕ12-115F/U1), ST-2 (Lonza, кат.№BE 12-115F/U1). На Фіг.15С і D показано, що зв'язування ED-B є високо специфічним до мишачим клітинам Balb3T3 і ST-2. Не спостерігалося зв'язування з моноцитами/макрофагами (необробленими) (дані не показані).

Як сказано вище, Фіг.16А показує специфічність 1041-D11 в зрізах тканин. Були оцінені тканини пухлин F9 з семи проб. Імуногістохімія з 500 нМ 1041-D11 дала специфічне забарвлення судин ED-B на пухлинах F9 від мишей. ED-B є високо специфічним маркером для судинної мережі пухлини. Білок-мішень EDB розташований на аблюминальной стороні судин. 1041-D11 специфічно декорує судинну мережу в зрізах тканейли перевірені 48 тканин; не спостерігалося неспецифічного фарбування в будь-який з 48 тканин у релевантній панелі FDA. Фіг.16В показує акумуляцію 1041-D11 в клітинах пухлини порівняно з убиквитином дикого типу. Таким чином, складові білки на основі модифікованого убіквітину, специфічно зв'язуються з ED-B, підходять для цільової ракової терапії на основі ED-B.

Приклад 7: Дослідження in vivo ефективності варіанта 1041D11-TNF-альфа

Для того, щоб встановити терапевтичну ефективність варіанту 1041-D11-TNF-альфа, це з'єднання перевірили на тератоме F9 (дивіться, Бореи та ін. (Borsi et al.), 2003 Blood 102, 4384-4392) в мьппиних моделях. Експресія ED-B у мишей порівнянна з людиною в ситуації in vivo і підходить для оцінки терапевтичного впливу 1041-D11-mTNF-альфа на рак, переважно у поєднанні з цитотоксичною з'єднанням, таким як мелфалан. Тератома F9 є агресивною пухлиною з високою щільністю судин. Бореи та ін. описали, що націлювання мишачого TNF-альфа через антитіла до EDB підвищують ефективність мелфалан, що демонструється уповільненням росту пухлини. Графік експериментів для дослідження ефективності був узятий у Бореи, 2003.

На стадії 1 визначали фармакологічно активну й переноситься дозу з кінцевими точкамчто 1041D11-TNF-альфа переносимо при самій високій дозі (6,75 пмоль/р), але не надає переважної дії на ріст пухлини (>10% маси тіла через 3,4 та 8 діб → потім тварини забивались), тоді kak104D11-TNF-альфа в самій низькій дозі (0,25 пмоль/г), як здається, сповільнює ріст пухлини. Використані далі групи дозувань знижували з 2,25 пмоль/р 1041D11-TNF-альфа.

На стадії 2 дослідження визначали залежить від дози ефективність з мелфаланом при кінцевій точці уповільнення росту пухлини (втрата маси тіла тварин >10%, пухлина >10% маси тіла, виразка пухлини). У даному дослідженні були перевірені 1041D11/mTNFa і мишачий TNFa у поєднанні з мелфаланом. Використовували 168 тварин, 14 груп дозувань (по 8 мишей у групі, брали, коли пухлини F9 досягали 300-400 мм3); за внутрішньовенним введенням досліджуваної проби слідувала інтраперитоніальна ін'єкція мелфалан через 24 години. Графік дозування показаний в таблиці 1.

Таблиця 1
ГрупаПеревіряється об'єктДозаШлях введенняОбсяг введенняКількість. тварин*
Білки TNF-α (пмоль/г)
1ФСБ00ВВ10 мл/кг8
2Мишачий складовою білок TNF-α02,25ВВ10 мл/кг8
3Мишачий складовою білок TNF-α00,75ВВ10 мл/кг8
4Мишачий складовою білок TNF-α00,25ВВ10 мл/кг8
5Мишачий складовою білок TNF-α00,025В�>Мишачий складовою білок TNF-α00,0025ВВ10 мл/кг8
7Мелфалан4,50ІП10 мл/кг8
8Мелфалан/ мишачий складовою білок TNF-α*4,52,25ІП/ВВ10/10 мл/кг8
9Мелфалан/ мишачий складовою білок TNF-α*4,50,75ІП/ВВ10/10 мл/кг
10Мелфалан/ мишачий складовою білок TNF-α*4,50,25ІП/ВВ10/10 мл/кг8.
110,025ІП/ВВ10/10 мл/кг8
12Мелфалан/ мишачий складовою білок TNF-α*4,50,0025ІП/ВВ10/10 мл/кг8'
13Мишачий TNF-α00,25ВВ10 мл/кг8
14Мелфалан/ мишачий TNF-α*4,50,25ІП/ВВ10/10 мл/кг8

На Фіг.18 показано відносний ріст пухлини під час лікування (7 діб). Фіг.18а чітко показує, що наше з'єднання 1041-D11-TNF-альфа в поєднанні з мелфала-ном скорочує відносний ріст пухлини більш ефективно ніж mTNF-альфа в поєднанні з мелфаланом або чим тільки мелфалан. Кінетика росту пухлини через 7 діб після лікування свідчить про значне скорочення пухлин при M., F. Viti, L. Zardi, B. Spiess, and D. Neri. 1999. Selective targeting and photocoagulation of ocular angiogenesis mediated by a phage-derived human antibody fragment. Nat Biotechnol 17:984-8.

2. Brenmoehl, J. M. Lang, M. Hausmann, S. N. Leeb, W. Falk, J. Scholmerich, M. Goke, and G. Rogler. 2007. Evidence for a differential expression of fibronectin splice forms ED-A і ED-B in Crohn's disease (CD) mucosa. Int J Colorectal Dis 22:611-23.

3. Dubin, D., J. H. Peters, L. F. Brown, B. Logan, K. C. Kent, B. Berse, S. Berven, Ст. Cercek, B. G. Sharifi, R. E. Pratt et al. 1995. Balloon catheterization induced arterial expression of embryonic fibronectins. Arterioscler Thromb Vase Товарbiol 15:1958-67.

4. Goodsell, D. S. 2001. FUNDAMENTALS OF CANCER MEDICINE: The Molecular Perspective: Antibodies. The Oncologist 6:547-548.

5. Kaczmarek, J., P. Castellani, G. Nicolo, B. Spina, G. Allemanni, and L. Zardi.

1994. Distribution of oncofetal fibronectin isoforms in normal, hyperplastic and neoplastic human breast tissues. Int J Cancer 59:11 -6.

6. Menrad, A., and H. D. Menssen. 2005. ED-B fibronectin as a target for antibody-based cancer treatments. Expert Opin Ther Targets 9:491-500.

7. Pujuguet, P., A. Hammann, M. Moutet, J. Samuel L., F. Martin, and M. Martin.

1996. Expression of fibronectin ED-A+and ED-B+isoforms by human and experimental colorectal cancer. Contribution of cancer cells and tumor-associated myofibroblasts. Am J Pathol 148:579-92.

8. Trachsel, E. M. Kaspar, F. Bootz, M. Detmar, and D. Neri. 2007. A human mAb specific to oncofetal fibronectin selectively targets chronic skin inflammation in vivo. J Invest Dermatol 127:881 -6.

9. Van Vliet, A., H. J. Baelde, L. J. Vleming, E. de Heer, and J. A. Bruijn. 2001.

Distribution of fibronectin isoforms in human renal disease. J Pathol 193:256-62.

10. Lipovsek, D., and Pluckthun, A. (2004). In-vitro protein evolution by ribosome display and mRNA display. J. Immunol. Methods 290,51-67.

11. Ohashi, H., Shimizu, Y„ Ying, B. W., and Ueda, T. (2007). Efficient protein selection based on ribosome display system with purified components. Biochem Biophys. Res. Commun. 352,270). Ribosome display: selecting and evolving proteins in vitro that specifically bind to a target. Nat. Methods 4, 269-279.

1. Білок, здатний зв'язувати экстрадомен (ED-B) фібронектину, що складається з модифікованого гетеродимерного убиквитинового білка, в якому два мономерних убиквитинових ланки пов'язані між собою в розташуванні "голова до хвоста" безпосередньо або через лінкера, відрізняється тим, що кожен мономер згаданого димерного білка по-різному модифікований шляхом заміщень щонайменше 6 амінокислот у положеннях 4, 6, 8, 62, 63, 64, 65 і 66 SEQ ID NO: 1, причому згадані заміщення включають:
у першому мономерном ланці заміщення в амінокислотних положеннях 4, 6, 62, 64, 65, і 66 за SEQ ID NO: 1,
відрізняється тим, що заміщення здійснюється наступним чином:
у першому мономерном ланці заміщення в амінокислотних позиціях 4, 6, 62, 64, 65 і 66, причому в положенні 4 F заміщується на W, в положенні 6 K заміщується на Н, W, F, в положенні 62 Q заміщується на N, в положенні 64 Е заміщується на K, R або Н, в положенні 65 S заміщується на L, F або W, а в положенні 66 Т заміщується на S або Р;
і
у другому мономерном ланці заміщення в амінокислотних положеннях 6, 8, 62, 63, 64, 65 і 66; де K в положенні 6 заміщується на Т, N, S або Q, L в положенні 8 заміщується на Q, Т, N або S, Q в положенні 62 заї 65 заміщується на F або W, Т у положенні 66 заміщується на Ті або D; де мономерное ланка необов'язково включає додаткові амінокислотні заміни, що не впливають на активність білка,
і причому згаданий білок має специфічну спорідненість пов'язує зі згаданим доменом ED-B фібронектину КД=10-7-10-12М і проявляє одновалентную зв'язуючу активність по відношенню до згаданого экстрадомену (ED-B) фібронектину.

2. Білок за п. 1, який відрізняється тим, що обидва мономеру убіквітину пов'язані за допомогою лінкера, має щонайменше послідовність GIG або щонайменше SGGGG, переважно або SGGGGIG, або SGGGGSGGGGIG (SEQ ID NO: 32).

3. Кон'югат для лікування захворювань, асоційованих з гіперпродукцією ED-В, що включає білок по кожному з пп. 1 і 2, об'єднаний з фармацевтично активним компонентом, який відрізняється тим, що згаданий фармацевтично активний компонент є цитокіном, хемокином, цитотоксичним з'єднанням або ферментом.

4. Кон'югат за п. 3, який включає гетеродимер убіквітину з SEQ ID NO: 33 або 34, або 47 або має аминокислотную ідентичність щонайменше 90% чи 95% з послідовністю SEQ ID NO: 33 або 34, або 47.

5. Кон'югат за п. 3 або 4, що має білкову природу.

6. Кон'югат за п. 3, отличаючтительно відрізняється тим, що згаданий складовою білок має послідовність SEQ ID NO: 35 або 36, або відрізняється тим, що SEQ ID NO: 47 об'єднана з TNF-альфа або його похідних або має аминокислотную ідентичність щонайменше 90% чи 95% з послідовністю SEQ ID NO: 35 або 36, або з SEQ ID NO: 47, об'єднаної з TNF-альфа або його похідних.

7. Кон'югат для діагностики захворювань, асоційованих з гіперпродукцією ED-B, включає білок по кожному з пп. 1 і 2, об'єднаний з діагностично активним компонентом, який відрізняється тим, що згаданий діагностично активний компонент є флуоресцентним з'єднанням, фотосенсибілізатором або радіонуклідом.

8. Кон'югат за п. 7, який включає гетеродимер убіквітину з SEQ ID NO: 33 або 34, або 47 або має аминокислотную ідентичність щонайменше 90% чи 95% з послідовністю SEQ ID NO: 33 або 34, або 47.

9. Фармацевтична композиція для лікування захворювань, асоційованих з гіперпродукцією ED-B, що містить білок, здатний зв'язувати домен ED-B фібронектину, будь згідно з пп. 1 і 2 в фармацевтично ефективному кількості, додатково містить один або більше хіміотерапевтичних агентів і один або більше фармацевтично прийнятних носіїв або наповнювачів.

<�онъюгат по кожному з пп. 3-6 фармацевтично ефективному кількості і додатково містить один або більше хіміотерапевтичних агентів і один або більше фармацевтично прийнятних носіїв або наповнювачів.

11. Фармацевтична композиція з п. 9 або 10, відрізняється тим, що згадані хіміотерапевтичні агенти вибирають з мелфалан, доксорубіцину, циклофосфаміду, дактиномицина, фтордезоксиурацила, цисплатину, паклітакселу і гемцитабина, або з групи інгібіторів кінази, або радіофармацевтичних препаратів.

12. Фармацевтична композиція з п. 11, яка знаходиться у формі об'єднаного препарату або у формі набору окремих компонентів.

13. Полинуклеотид, що кодує рекомбінантний білок згідно кожному з пп. 1 і 2.

14. Полинуклеотид, що кодує кон'югат за п 5.

15. Вектор експресії, що включає полинуклеотид за п. 13.

16. Вектор експресії, що включає полинуклеотид за п. 14.

17. Клітина-господар для експресії білка будь згідно з пп. 1 і 2, що включає полинуклеотид за п. 13.

18. Клітина-господар для експресії кон'югату з п. 5, що включає полинуклеотид за п. 14.

19. Клітина-господар для експресії білка будь згідно з пп. 1 і 2, що містить вектор експресії по п. 15.

20. ля діагностики ED-B-асоциированних захворювань, включає ефективне кількість білка будь згідно з пп. 1 і 2 з діагностично прийнятним носієм.

22. Композиція для діагностики ED-B-асоційованих захворювань, що включає ефективне кількість кон'югату згідно кожному з пп. 7 та 8 з діагностично прийнятним носієм.

23. Спосіб створення білка будь згідно з пп. 1 і 2, що включає наступні етапи:
а) забезпечення сукупності по-різному модифікованих димеризованих убиквитинових білків, що відбуваються з мономерних убиквитинових білків, причому згадана сукупність складається з димеризованих убиквитинових білків, що включають два модифікованих
мономеру убіквітину, пов'язаних між собою в розташуванні "голова до хвоста", причому кожен мономер згаданого димерного білка по-різному модифікований шляхом заміщення щонайменше 6 амінокислот у положеннях 4, 6, 8, 62, 63, 64, 65 і 66 з SEQ ID NO: 1,
причому згадані заміщення включають:
у першому мономерном ланці заміщення в амінокислотних положеннях 4, 6, 62, 64, 65 і 66, причому в положенні 4 F заміщується на W, в положенні 6 K заміщується на Н, W, F, в положенні 62 Q заміщується на N, в положенні 64 Е заміщується на K, R або Н, в положенні 65 S заміщується на L, F або W, а в положенні 66 Т заміщується на S або в положенні 6 заміщується на Т, N, S або Q, L в положенні 8 заміщується на Q, Т, N або S, Q в положенні 62 заміщується на W, F, K в положенні 63 заміщується на S, t, N або Q, Е в положенні 64 заміщується на N, S, Т або Q, S у положенні 65 заміщується на F або W, Т в положенні 66 заміщується на Ті або D,
де мономерное ланка необов'язково включає додаткові амінокислотні заміни, що не впливають на активність білка;
b) надання экстрадомена (ED-B) фібронектину в якості потенційного ліганду;
c) контакт згаданої сукупності по-різному модифікованих білків з згаданим экстрадоменом (ED-B) фібронектину;
d) ідентифікація модифікованого димерного убиквитинового білка способом скринінгу, причому згаданий модифікований димерний убиквитиновий білок зв'язується з згаданим экстрадоменом (ED-B) фібронектину зі специфічним зв'язує спорідненістю при значенні КД в діапазоні 10-7-10-12М і проявляє активність одновалентного зв'язування по відношенню до згаданого экстрадомену (ED-B) фібронектину.

24. Спосіб за п. 21, відрізняється тим, що згадану сукупність по-різному модифікованих білків отримують шляхом генетичного об'єднання двох бібліотек ДНК, кожна з яких відповідає за одержання по-різному мотличающийся тим, що білок згідно кожному з пп. 1 і 2 конъюгирован з фармацевтично активним компонентом, який відрізняється тим, що згаданий фармацевтично активний компонент є цитокіном, хемокином, цитотоксичним з'єднанням або ферментом.

26. Спосіб створення кон'югату згідно кожному з пп. 7 та 8, відрізняється тим, що білок згідно кожному з пп. 1 і 2 конъюгирован з діагностично активним компонентом, який відрізняється тим, що згаданий діагностично активний компонент є флуоресцентним з'єднанням, фотосенсибілізатором або радіонуклідом.

27. Застосування рекомбінантного білка по кожному з пп. 1 і 2 або кон'югату згідно кожному з пп. 3-6 для лікування захворювань, асоційованих з гіперпродукцією ED-B.

28. Застосування рекомбінантного кон'югату згідно кожному з пп. 7 та 8 для діагностики захворювань, асоційованих з гіперпродукцією ED-B.



 

Схожі патенти:

Штам клітин яєчників китайського хом'яка - продуцент рекомбінантного антитіла проти фактора некрозу пухлини альфа людини

Винахід відноситься до галузі біотехнології, конкретно до рекомбінантної продукції білків людини, і може бути використане у виробництві химерних антитіл до фактора некрозу пухлини людини. Отриманий штам клітин яєчників китайського хом'яка CHO-Inflix 20/5, трансфекованих векторами, экспрессирующими легку і важку ланцюга химерного антитіла проти фактора некрозу пухлини альфа (ФНП-α) людини. Депонований штам в Російську колекції клітинних культур під №РККК(П)760Д. Винахід дозволяє отримувати химерное антитіло з питомою продуктивністю не менш 33,5 пикограмм на клітку в добу. 4 іл., 2 табл., 4 пр.

Пептиди, які проникають у клітини, і їх застосування

Винахід відноситься до галузі біотехнології, конкретно до інтерналізації терапевтичних молекул всередину клітини, і може бути використане в медицині. Отримують композицію для доставки молекул нуклеїнових кислот в клітини, що містить щонайменше один пептид з щонайменше 92% ідентичністю до GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); або YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), приєднаний до однієї або кількох молекул нуклеїнових кислот. Винахід дозволяє підвищити ефективність доставки молекул нуклеїнових кислот всередину клітини ссавця за рахунок пептиду, здатного интернализироваться всередину клітини ссавця з ефективністю, що становить щонайменше 200% від ефективності інтерналізації пептиду ТАТ, має аминокислотную послідовність GRKKRRQRRRPPQ (SEQ ID NO: 1). 5 н. і 3 з.п. ф-ли, 16 іл., 1 табл., 8 пр.

Рекомбінантна плазмидная днк, що кодує химерное антитіло проти фактора некрозу пухлини-альфа людини, лінія экуариотических клітин-продуцент химерного антитіла і спосіб отримання химерного антитіла

Група винаходів відноситься до галузі біотехнології. Запропоновано рекомбінантна плазмидная ДНК, що кодує химерное антитіло проти фактора некрозу пухлин-альфа людини (ФНП-альфа), на основі плазміди pOptiVECTM-TOPO®. Розглянуто лінія эукариотических кліток в якості продуцента антитіла проти ФНП-альфа, спосіб її отримання шляхом трансфекції плазмідної ДНК з винаходу, а також спосіб отримання химерного антитіла проти ФНП-альфа шляхом культивування лінії клітин по винаходу. Даний винахід забезпечує збільшення рівня синтезу антитіл проти ФНП-альфа клітинами-продуцентами. 4 н. і 8 з.п. ф-ли, 8 іл., 1 табл., 3 пр.

Члени зв'язування проти il-1r1

Винахід відноситься до галузі біотехнології та імунології. Описано різні варіанти антитіл, специфічні щодо IL-1R1. Розкриті антитіла можуть бути придатні для лікування розладів, опосередкованих IL-1R1, включаючи ревматоїдний артрит, астму, хронічне обструктивне захворювання легень (ХОЗЛ). Запропонована група винаходів може бути використана в медицині. 13 н. і 8 з.п.ф-ли, 14 іл., 12 табл., 5 пр.

Спосіб ідентифікації гетеромультимерних модифікованих убиквитинових білків зі здатністю зв'язуватися з лігандами

Винахід відноситься до галузі біотехнології і може бути використано для ідентифікації гетеромультимерних убиквитинов зі здатністю зв'язуватися з лігандом-антигеном. Спосіб включає контактування сукупності гетеродимерних модифікованих убиквитинов, включають два мономеру убіквітину, пов'язаних між собою за схемою голова до хвоста, з потенційним лігандом дисплейним способом. При цьому кожен із згаданих мономерів модифікований по-різному і містить 5-8 заміщень в положеннях 2, 4, 6, 8, 62, 63, 64, 65, 66 і 68 SEQ ID NO:1. Далі ідентифікують гетеродимерний модифікований білок, связавшийся з лігандом з спорідненістю зв'язування Kd в діапазоні 10-7-10-12 М і одновалентной зв'язує активністю. Запропоновані ДНК-бібліотеки, що відповідають за отримання популяції згаданих гетеромультимерних убиквитинов, а також бібліотеки білків, отримані шляхом експресії згаданих ДНК-бібліотек. Винахід дозволяє отримати нові зв'язуючі білки на основі гетеромультимерного убіквітину, здатні специфічно зв'язуватися з високою спорідненістю з вибраними лігандами. 3 н. і 5 з.п. ф-ли, 17 іл., 4 пр.

Нейтралізуючі антитіла проти вірусу грипу а і їх використання

Пропонований винахід відноситься до імунології. Запропоновані варіанти антитіл, що нейтралізують інфекцію субтипу групи 1 та субтипу групи 2 вірусу грипу А. Антитіло характеризується: або набором 3 CDR легкої і 3 СDR важкої ланцюга, або наявністю варіабельних ділянок легкої і важкої ланцюгів. Розкриті: кодує антитіло молекула нуклеїнової кислоти; экспрессирующая антитіло клітина; а також спосіб ослаблення інфекції вірусу грипу А або зниження його ризику, що використовує антитіло в терапевтично або профілактично ефективному кількості. Використання винаходу забезпечує нейтралізують вірус грипу А антитіла, які можуть знайти застосування в медицині при лікуванні грипу субтипов: H1, H2, H3, H5, H7, H9. 6 н. і 12 з.п. ф-ли, 6 табл., 2 пр.

Вакцини на основі свинячого вірусу torque teno і способи діагностики інфекцій, викликаних цим вірусом

Винаходи стосуються інфекційної молекули нуклеїнової кислоти, кодує інфекційний вірус Torque teNO свиней (PTTV), яка містить щонайменше одну копію геномної послідовності, обраної з групи, що складається з послідовностей, відповідних генотипам або підтипів PTTV1a-VA, PTTV1b-VA, PTTV2b-VA і PTTV2c-VA, а також біологічно функціональної плазміди або вірусного вектора, що містить таку інфекційну нуклеотидну геномну послідовність, і клітини-господаря, що містить таку плазміду або вектор. Крім того, представлені винаходи передбачають живі, аттенюированние, экспрессируемие при використанні вектора і очищені рекомбінантні капсидние субодиничні або вбиті вірусні вакцини для захисту проти PTTV інфекції, а також способи імунізації свиней проти PTTV вірусної інфекції шляхом введення такої вакцини. Охарактеризовані винаходу можуть бути використані для запобігання інфекції, спричиненої вірусом Torque teNO свиней. 11 н. і 12 з.п. ф-ли, 53 іл., 5 табл., 24 пр.

Спосіб отримання системи спрямованої доставки білкових молекул (онколитических білків) в пухлинні тканини на основі активованих лімфоцитів

Винахід відноситься до галузі біотехнології, конкретно до лентивирусной доставки апоптина в пухлинні тканини, і може бути використане в медицині. Спосіб включає отримання лентивірусного конструкта, экспрессирующего модифікований апоптин, злитий з секреторним сигналом лактотрансферрина і трансдукторним сигналом (ST-CTP-апоптин), з подальшим отриманням рекомбінантних лентивирусних частинок, дефектних за реплікації і несучих модифікований апоптин, які потім вводяться в Т-лімфоцити (TILs), отримані при хірургічному видаленні пухлини або в процесі отримання біопсії, які мають здатність проникати в пухлинні тканини. Далі отримані TILs аутотрансплантируют вказаною пацієнту. Винахід дозволяє підвищити здатність апоптина проникати в пухлинні клітини і надавати онколитический ефект у відношенні всіх клітин пухлини. 2 іл., 3 пр.
Винахід відноситься до галузі біотехнології і генетичної інженерії. Запропоновано спосіб отримання щонайменше однієї трансфицированной эукариотической клітини-господаря, экспрессирующей цільовий продукт, що включає введення в клітину полинуклеотида, що кодує цільовий продукт, і полинуклеотида, що кодує мутантний фермент дигидрофолатредуктазу принаймні одним вектором експресії, отримання безлічі эукариотических клітин-господарів, життєздатність яких залежить від споживання фолата, причому зазначені эукариотические клітини-господарі включають щонайменше чужорідний полинуклеотид, що кодує цільовий продукт, і чужорідний полинуклеотид, що кодує фермент дигидрофолатредуктазу (ДГФР), культивування зазначеного безлічі эукариотических кліток-господарів у селективної культуральному середовищі, включає метотрексат у концентрації 2,3-500 нМ і фолієву кислоту в концентрації 12,5-50 нМ, і відбір щонайменше однієї эукариотической клітини-господаря, экспрессирующей цільовий продукт. Також описаний спосіб одержання цільового продукту і клітинної культурального середовища. 3 н. і 8 з.п. ф-ли, 2 табл., 2 пр.

Зв'язують протеїни, специфічні по відношенню до інсулін-подібним факторам зростання, і їх використання

Даний винахід відноситься до галузі імунології. Запропоновано повністю людське моноклональне антитіло, яке зв'язує інсуліноподібний фактор росту-II (IGF-II) і має перехресну реактивність IGF-I, а також його антигенсвязивающий фрагмент. Розглянуто молекула нуклеїнової кислоти, що кодує антитіло щодо винаходу, вектор і клітина-господар для експресії антитіла щодо винаходу. Описана фармацевтична композиція, а також кон'югати для лікування та діагностики злоякісної пухлини, застосування антитіла щодо винаходу в отриманні лікарського засобу та спосіб визначення рівня IGF-II і IGF-I в пробі пацієнта. Даний винахід може знайти подальше застосування в терапії раку. 8 н. і 8 з.п. ф-ли, 27 пр., 18 табл.

Спосіб ідентифікації гетеромультимерних модифікованих убиквитинових білків зі здатністю зв'язуватися з лігандами

Винахід відноситься до галузі біотехнології і може бути використано для ідентифікації гетеромультимерних убиквитинов зі здатністю зв'язуватися з лігандом-антигеном. Спосіб включає контактування сукупності гетеродимерних модифікованих убиквитинов, включають два мономеру убіквітину, пов'язаних між собою за схемою голова до хвоста, з потенційним лігандом дисплейним способом. При цьому кожен із згаданих мономерів модифікований по-різному і містить 5-8 заміщень в положеннях 2, 4, 6, 8, 62, 63, 64, 65, 66 і 68 SEQ ID NO:1. Далі ідентифікують гетеродимерний модифікований білок, связавшийся з лігандом з спорідненістю зв'язування Kd в діапазоні 10-7-10-12 М і одновалентной зв'язує активністю. Запропоновані ДНК-бібліотеки, що відповідають за отримання популяції згаданих гетеромультимерних убиквитинов, а також бібліотеки білків, отримані шляхом експресії згаданих ДНК-бібліотек. Винахід дозволяє отримати нові зв'язуючі білки на основі гетеромультимерного убіквітину, здатні специфічно зв'язуватися з високою спорідненістю з вибраними лігандами. 3 н. і 5 з.п. ф-ли, 17 іл., 4 пр.

Спосіб отримання системи спрямованої доставки білкових молекул (онколитических білків) в пухлинні тканини на основі активованих лімфоцитів

Винахід відноситься до галузі біотехнології, конкретно до лентивирусной доставки апоптина в пухлинні тканини, і може бути використане в медицині. Спосіб включає отримання лентивірусного конструкта, экспрессирующего модифікований апоптин, злитий з секреторним сигналом лактотрансферрина і трансдукторним сигналом (ST-CTP-апоптин), з подальшим отриманням рекомбінантних лентивирусних частинок, дефектних за реплікації і несучих модифікований апоптин, які потім вводяться в Т-лімфоцити (TILs), отримані при хірургічному видаленні пухлини або в процесі отримання біопсії, які мають здатність проникати в пухлинні тканини. Далі отримані TILs аутотрансплантируют вказаною пацієнту. Винахід дозволяє підвищити здатність апоптина проникати в пухлинні клітини і надавати онколитический ефект у відношенні всіх клітин пухлини. 2 іл., 3 пр.

Рекомбинантное отримання пептидів

Група винаходів відноситься до біотехнології. Запропоновано білок-попередник для рекомбінантного отримання пептидів з послідовності довжиною від 5 до 70 амінокислотних залишків. Зазначений білок містить расщепляемую повторювану послідовність цільових пептидних елементів (Pep) і допоміжних пептидних елементів (Aux) загальної формули: (Pep-Aux)x або (Aux-Pep)x, де x>1. Елементи Aux містять самозбираючий пептидний елемент (SA). Елементи Pep містять аминокислотную послідовність з послідовності довжиною від 5 до 70 амінокислотних залишків, і на кінцях елементів Pep знаходяться расщепляемие послідовності, які забезпечують можливість вивільнення Pep елементів з білка-попередника допомогою специфічного розщеплення. Запропоновані також молекула нуклеїнової кислоти з послідовністю нуклеїнової кислоти, кодує зазначений білок-попередник, экспрессионная касета і рекомбінантний вектор експресії, що містять послідовність зазначеної нуклеїнової кислоти. Запропоновані також варіант білка-попередника, спосіб отримання цільового пептиду Рер, а також застосування амфифильного пептиду для рекомбінантного отримання протимікробного цільового пеп

Поліпептиди, селективні щодо интегрина αvβ3, кон'юговані з варіантом челевеческого сироваткового альбуміну (hsa), і їх фармацевтичні застосування

Винахід відноситься до галузі біотехнології, конкретно до злитим білків, містить варіант родостомина, і може бути використане в медицині. Отримують поліпептид, селективний щодо интегрина αvβ3, що складається з амінокислотної послідовності SEQ ID NO:1, кон'югованих на N-кінці допомогою линкерной амінокислотної послідовності, що містить комбінацію амінокислот гліцину і серину, з варіантом людського сироваткового альбуміну (HSA) із SEQ ID NO:4. Винахід дозволяє підвищити ефективність терапії захворювань, пов'язаних з интегрином αvβ3. 8 н. і 4 з.п. ф-ли, 14 іл., 2 табл., 7 пр.

Злитий білок dlk1-fc і його застосування для інгібування метастазів раку, полинуклеотид, що кодує білок, вектор, клітина-господар, спосіб отримання злитого білка, композиція та спосіб інгібування метастазів раку

Представлена група винаходів відноситься до галузі біотехнології і стосується злитого білка DLK1-Fc і його застосування для інгібування метастазів раку, полинуклеотида, що кодує такий білок, экспрессионного вектора, що містить полинуклеотид, клітини-господаря, продукуючої зазначений злитий білок, способу отримання злитого білка шляхом культивування зазначеної клітини-господаря, композиції, що містить зазначений злитий білок, і способу інгібування метастазів раку. Охарактеризований злитий білок містить позаклітинний розчинний домен DLK1, що складається з амінокислотної послідовності SEQ ID NO:4 і Fc-домену людського антитіла. Представлена група винаходів може бути використана для одержання лікарського засобу для зниження міграції ракових клітин і інгібування метастазів раку. 8 н. і 3 з.п. ф-ли, 36 іл., 3 пр.

Дисплей на поверхні клітин поліпептидних ізоформ на основі прочитання терминирующего кодона

Винахід відноситься до галузі молекулярної біології та генетичної інженерії. Запропоновано спосіб селекції эукариотической клітини-господаря, экспрессирующей бажаний рівень цікавить поліпептиду, що включає трансфекцію клітин гетерологичной нуклеїнової кислотою, що містить щонайменше одну касету, що містить щонайменше перший полинуклеотид, що кодує зацікавив поліпептид, стоп-кодон, розташований за напрямом експресії щодо першого полинуклеотида, другий полинуклеотид, розташований за напрямом експресії щодо стоп-кодона, який кодує иммуноглобулиновий трансмембранний якірний домен, культивування клітин-господарів для експресії цікавить поліпептиду так, щоб принаймні частина даного поліпептиду экспрессировалась у вигляді злитого поліпептиду, що містить иммуноглобулиновий трансмембранний якірний домен, причому такий злитий поліпептид експонується на поверхні зазначеної клітини-господаря, селекцію клітини за наявності або кількістю злитого поліпептиду, экспонируемого на клітинній поверхні. Винахід може бути використана в біотехнології для селекції високопродуктивних клітинних ліній. 6 н. і 9 з.п.

Модифікований фактор віллебранда з подовженим напівперіодом існування in vivo, його застосування та способи отримання

Винахід відноситься до галузі біотехнології, конкретно до модифікованому фактору Віллебранда (VWF), і може бути використане в медицині. Рекомбінантним шляхом отримують модифікований VWF, злитий в С-кінцевій частині свого первинного продукту трансляції з N-кінцевою частиною альбуміну допомогою лінкера SSGGSGGSGGSGGSGGSGGSGGSGGSGGSGS. Отриманий модифікований VWF використовують у складі фармацевтичної композиції для лікування або профілактики порушення згортання крові. Винахід дозволяє отримати модифікований VWF, який зберігає здатність до N-кінцевий дімерізаціі і С-кінцевої мультимеризации, маючи при цьому подовжений напівперіод функціонального існування в плазмі крові порівняно з напівперіодом функціонального існування VWF. 8 н. і 9 з.п. ф-ли, 5 іл., 4 табл., 11 пр.

Злитий білок тиоредоксина і домену 4 инфестина, спосіб його одержання, экспрессионная плазмидная днк, що кодує злитий білок, і бактерії роду escherichia coli, трансформована такий плазмідної днк

Винаходи належать до галузі біотехнології і стосуються злитого білка для специфічного інгібування згортання крові, экспрессионной плазмідної ДНК, що кодує такий злитий білок, бактерії, що належить до роду Escherichia, трансформованої такий ДНК, і способу отримання злитого білка. Представлений злитий білок включає тиоредоксин I E.coli і инфестин-4 і характеризується послідовністю SEQ ID NO:2. Плазмидная ДНК містить послідовність SEQ ID NO:1, що кодує представлений злитий білок, що знаходиться під контролем промотору, функціонуючого в бактеріальній клітині. Спосіб отримання згаданого злитого білка включає культивування згаданих бактерій у живильному середовищі, руйнування бактеріальних клітин і очищення зазначеного злитого білка з використанням металлохелатной хроматографії і аніонообмінних хроматографії. Охарактеризовані рішення дозволяють отримати білок, що забезпечує зазначену специфічність, з подальшим його використанням в блокуванні контактної активації згортання крові за рахунок інгібування XIIa фактора і відсутності інгібування Ха фактора. 4 н.п. ф-ли, 10 іл., 7 пр.

Штучний ген mel-tci-a0201, що кодує полиэпитопний білок-иммуноген mel-tci-a0201, рекомбінантна плазмидная днк pmel-tci-a0201, забезпечує експресію штучного гена mel-tci-a0201 і штучний білок-иммуноген mel-tci-a0201, що містить множинні ctl - і th-епітопи антигенів меланоми

Винахід відноситься до галузі біохімії, зокрема до штучних білків-иммуногенам, що мають властивості антигенів меланоми. Заявлений штучний ген, що кодує полиэпитопний білок-иммуноген MEL-TCI-A0201, що містить множинні цитотоксичні рестриктированние HLA-A*0201 і Т-хелперние епітопи антигенів меланоми NY-ESO-1, MART1, MAGE-A1, MAGE-A3, MAGE-A11, MAGE-C1, має послідовність довжиною 1535 п.н., представлену на Фіг. 3. Також заявлені рекомбінантна плазмидная ДНК, що містить зазначений штучний ген, і білок-иммуноген MEL-TCI-A0201 з властивостями антигенів меланоми. Винахід дозволяє підвищити імуногенність штучного полиэпитопного Т-клітинного иммуногена, індукує більш високий рівень відповіді цитотоксичних Т-лімфоцитів. 3 н.п. ф-ли, 11 іл., 3 табл., 2 пр.

Рекомбінантна днк, що кодує гібридний білок епідермального фактора росту людини злитого послідовністю глутатіон-s-трансферази (gst-hegf) і рекомбінантна плазміда pas007, що забезпечує синтез gst-hegf в клітинах escherichia coli

Винахід відноситься до біотехнології, зокрема генно-інженерного отримання білків людини, і може бути використано для отримання епідермального фактора росту людини (чЭФР) у клітинах бактерій у вигляді гібридного білка з глутатіон-3-трансферазой. Конструюють рекомбинантную ДНК, що кодує гібридний білок GST-hEGF, який складається з амінокислотної послідовності глутатіон-S-трансферази та амінокислотної послідовності епідермального фактора росту людини, розділених сайтом розщеплення энтерокиназой, і характеризується нуклеотидної послідовністю SEQ ID NO:1. На основі KpnI/XhoI-фрагмента вектора рЕТ41 і зазначеної рекомбінантної ДНК створюють рекомбинантную плазміду рАS007 для експресії гібридного білка GST-hEGF в клітинах E.coli. Винахід дозволяє досягти високих рівнів експресії GST-hEGF в клітинах E.coli. 2 н.п. ф-ли, 3 іл., 1 табл., 5 пр.

Спосіб екстракції днк з клітин крові

Винахід відноситься до галузі біотехнології. Запропоновано спосіб екстракції ДНК з клітин крові. Додають зразок магнітні частинки і феромагнітні наносфери CoNiFe2O4 50 нм. Лизируют біологічний матеріал. Промивають ДНК і знімають ДНК з носія. Перевагою заявленого способу є підвищення кількості ДНК в отриманому зразку. 3 іл., 1 пр.
Up!