Штам клітин яєчників китайського хом'яка - продуцент рекомбінантного антитіла проти фактора некрозу пухлини альфа людини

 

Винахід відноситься до біотехнології, зокрема до виробництва химерних антитіл до фактора некрозу пухлини людини.

Фактор некрозу пухлини (в даний час під цим терміном розуміється фактор некрозу пухлин альфа (ФНП-α) є цитокіном, продукуються поруч клітин і тканин, в першу чергу макрофагами, моноцитами, CD4+ і CD8+ Т-лімфоцитами у відповідь на стимуляцію бактеріальним ендотоксином (Кетлинський С. А., Симбирцев А.с С. Цитокіни, С-Пб, 2008). ФНП-α у своїй біологічно активній формі є тримером, і жолобок, утворений двома субодиницями, важливий для взаємодії цитокін-рецептор. Володіючи плейотропним дією, ФНП-α є медіатором запального процесу. У патологічних станах посилена продукція ФНП може супроводжуватися пошкодженням тканин, судинні та клітинними реакціями, що розвивають і підтримують хронічне запалення зокрема, підвищена продукція ФНП-α відіграє важливу роль при сепсисі, відторгнення трансплантатів та деяких аутоімунних захворювань, таких як ревматоїдний артрит, хвороба Крона, системна червона вовчанка, неспецифічний виразковий коліт, розсіяний склероз, автоімунний діабет, виразковий коліт і багато інших заЂезированние фармацевтичні засоби, здатні інгібувати активність прозапального цитокіну ФНП-α і тим самим впливати на симптоми ряду захворювань. У зв'язку з цим пошук інгібіторів ФНП-α набуває важливе практичне значення, так як речовина, що володіє достатньою специфічністю і селективністю відносно ФНП-α, може бути ефективним профілактичним або лікувальним фармацевтичним з'єднанням для попередження або лікування розладів, які ФНП-α залучається як причинний фактор. Найбільш перспективним напрямком при цьому є використання для цих цілей антитіл. Лікувальні засоби на основі антитіл мають суттєві переваги порівняно з хіміко-фармацевтичними препаратами, оскільки вони мають досконалу селективність відносно своєї мішені і низьку власну токсичність.

В даний час описані способи лікування токсичного шоку, регресії пухлин, інгібування цитотоксичності, аутоімунної хвороби, такий як ревматоїдний артрит і хвороба Крона, реакції "трансплантат проти господаря", бактеріального менінгіту з допомогою антитіл до ФНП-α (UA 2455312, 2012; US 6448380, 2002; US 6451983, 2002; US 6498237, 2002; US 5672347, 1997; US 5656272, 1997).

Однак поки що жодна з доступних в даний час лікарських обмеження з-за сильної токсичності. Крім того, традиційні антитіла володіють зв'язує активністю, яка залежить від рН, і, отже, вони не підходять для застосування в середовищах, що виходять за межі фізіологічного інтервалу рН, наприклад, при лікуванні шлункового кровотечі, операції на шлунку і т. п.

Серед антитіл, здатних інгібувати ФНП-α найбільш відомі, такі як інфліксімаб (Ремікейд) - химерное иммуноглобулиновое моноклональне антитіло до ФНП-α, адалімумаб (Хуміра) - людське моноклональне антитіло до ФНП-α, а також гібридні білки, такі як этанерцепт (Енбрел) - людський рекомбінантний білок-рецептор до ФНП-α і цертолизумаба пэгол (Симзия) - пегилированное моноклональне антитіло до ФНП-α, вільний від Fc-фрагмента (www.rheumatology.kiev.ua/wp-content/uploads/magazine/38/21.pd).

При цьому самий великий (понад 300000 пацієнтів) і тривалий (більше 6 років) клінічний досвід накопичений щодо препарату інфліксімаб (Ремікейд, Шерінг-Плау) - химерних моноклональних антитіл до фактора некрозу пухлини, який широко застосовується практично у всіх країнах світу, в тому числі в Росії (medline.uz/article/rheumatology/1177.htm). Препарат показав високу ефективність при лікуванні ревматоїдного артриту (після одноразового введення ефект тривав �езни Крона, при серонегативного спондилоартропатиях (Насонов Е. Л. Фактор некрозу пухлини - нова мішень для протизапальної терапії ревматоїдного артриту. Російський медичний журнал, 2000; 8 (17): 718-722; Furst D. E., Keystone Е., Maini R. N., Smolen J. S. Recapulation of the round table discussion - assessing the role of anti-tumor necrosis factor therapy in the treatment of rheumatoid arthritis. Rheumatol., 1999; 38 (suppl.): 50-53.; Van den Bosch F., Kruithof E., Baeten D., et al. Effects of loading a dose regіmen of three infusions of chimeruic monoclonal antibody to tumor necrosis factor a (infliximab) in spondyloarthropathy: an open pilot study. Ann. Rheum. Dis., 2000; 59: 428-433).

Химерное (миша-людина) антитіло інфліксімаб (Ремікейд) складається із змінної (Fv) області високоафинних нейтралізуючих мишачих моноклональних антитіл до ФНП, сполучених з фрагментом молекули IgG1k людини, в цілому займає дві третини молекули антитіла і забезпечує його ефекторні функції. Інфліксімаб пов'язує ФНП-α з Ка=1,8×109л/моль і ефективно нейтралізує його біологічну активність. За даними дослідів in vitro, препарат утворює стабільні комплекси з ФНП-α, ефективно пригнічує біологічну активність секрецируемого і мембран-асоційованого ФНП-α і викликає лізис ФНП-продукуючих клітин, комплемент-залежним шляхом або за рахунок антитіло-залежної клітинної цитотоксичності (www.mednovosti.by. Архів, №8, 1995).

Деталі�прессирующими легку і важку ланцюга, з подальшим очищенням секретированного антитіла з середовища культивування клітин (WO 9216553, 1992). Лінія на основі клітин миші SP2/0 - продуцент инфликсимаба була отримана понад 20 років тому з застосуванням технологій, що існували в той час, і не дозволяє отримувати антитіло з досить високим виходом. Крім того, в даний час встановлено, що глікозилювання білків, зокрема, антитіл, в клітинах миші має ряд відмінностей від глікозилювання в клітинах людини, що вказує на потенційну загрозу розвитку імунної відповіді при введенні рекомбінантних антитіл, що виробляються клітинами миші, в організм людини. У цьому зв'язку більш перспективним є отримання рекомбінантних антитіл для терапевтичного застосування в клітинах китайського хом'ячка (наприклад, в клітинах СНТ), де характер глікозилювання антитіл більш близький до людського (Raju T. S. Glycosylation variations with expression systems and their impact on biological activity of therapeutic immunoglobulins. BioProcess International, 2003: 44-52).

Найбільш близьким за технічною сутністю до заявляється винаходу є технологія отримання антитіла інфліксімаб у клітинах яєчників китайського хом'яка з використанням генів, що кодують легку і важку ланцюга химерного (миша-людина) антитіл�

Недоліком даної технології є досить складна технологія виділення цільового продукту (WO 2011015919, 2011) і за попередніми даними недостатньо високий вихід цільового продукту (в патенті інформація про результати використання винаходу відсутній).

Завданням, розв'язуваної авторами, було розширення асортименту використовуваних штамів культивованих клітин яєчників китайського хом'яка (СНО) з метою одержання штаму, що забезпечує більш високий і стабільний вихід химерного антитіла проти ФНП-α людини.

Технічною задачею була розробка нового більш ефективний штам клітин СНО-продуцент химерного антитіла проти ФНП-α людини

Технічний результат був досягнутий створенням штаму клітин яєчників китайського хом'яка CHO-Inflix 20/5 - продуцента химерного антитіла з питомою продуктивністю 33,5 пг антитіла на клітку в добу, шляхом трансформації клітин экспрессионними векторами, які містять Seq ID No 1 і 2, фізичні карти яких представлені на фіг. 1 і 2.

Даний штам клітин яєчників китайського хом'яка СНТ-Inflix 20/5 - продуцент химерних антитіл проти ФНП-α людини був поміщений в Російську колекції клітинних культур 16.09.2013 під № РККК(П)760Д.

Штам має �/p>

Причини депонування: Продуцент рекомбінантних химерних антитіл проти фактора некрозу пухлин (ФНП)-α людини

Родовід штами: Батьківська клітинна лінія CHOdhfr-. Котрансфекция плазмідами pIRES-DHFR/InflixH і pIRES-NEO/InflixL, відбір стабільного високопродуктивного клону на середовищі без гіпоксантину/тимидина з 500 мкг/мл G-418 і поступовим збільшенням концентрації метотрексату.

Число пасажів на час паспортизації і депонування: 20

Стандартні умови вирощування: Середа α-МЕМ з 4 нМ глутаміну, 10% фетальної сироватки, 500 мкг/мл G-418, 500 нМ метотрексату, 37°С, 5%2.

Культуральні властивості: Адгезійний тип росту, культивування в матрацах, посівна доза 10000 клітин/см2, досягнення моношару через 4 доби. Для зняття з пластику використовується розчин Версена-трипсин (1:1).

Характеристика культивування клітин в організмі тварини: культивування в організмі тварини не застосовується

Дані щодо видової приналежності: Cricetulus griseus (ПЛР-аналіз з видоспецифичними праймерами).

Маркерні ознаки штаму та методи їх оцінки: здатність до росту в присутності 500 мкг/мл G-418 і 500 нМ метотрексату

Контроль контамінації бактеріями, грибами, мікоплазмами і вірусів�антитіло (ізотип IgG1, каппа) до фактору некрозу пухлин альфа людини, нейтралізує біологічну активність ФНП-альфа (оцінка за допомогою імуноферментного аналізу, вестерн-блоту, біологічного тесту на клітинній лінії L-929)

Характеристика біосинтезу корисних продуктів (вихід продукту в середовище, рівень активності і спосіб її визначення): рекомбинантное антитіло секретується в культуральне середовище в кількості не менше 33,5 пг на клітку в добу. Стабільність культивування - не менше 30 пасажів.

Спосіб кріоконсервування: фетальна сироватка з 10% DMSO, 3-4×106клітин/мл, заморожування до -70°С зі швидкістю 1°С/хв, далі приміщення в рідкий азот, життєздатність після розморожування і відмивання від криоконсерванта 85% (з трипановим синім).

Суть винаходу пояснюється доданими кресленнями:

Фіг. 1. Карта экспрессионной плазміди pIRES-DHFR/InflixH, де CMV Promoter - промотор предранних білків цитомегаловірусу;

a-TNF chain heavy - ген важкої ланцюга химерного антитіла проти ФНП-альфа людини;

IRES - внутрішній сайт посадки рибосоми;

DHFR - ген дигідрофолатредуктази;

PolyA - сайт полиаденилирования РНК з гена гормону росту бика;

pUC Ori - точка початку реплікації;

AmpR - ген стійкості до аитомегаловируса;

a-TNF light chain - ген легкої ланцюга химерного антитіла проти ФНП-альфа людини;

Synthetic іntron - інтрон;

IRES - внутрішній сайт посадки рибосоми;

NEO - ген стійкості до неоміцину;

Poly А - сайт полиаденилирования РНК з гена гормону росту бика;

pUC Ori - точка початку реплікації;

AmpR - ген стійкості до ампіциліну;

Фіг. 3. Результати суспензійного культивування клітин штаму CHO-Inflix 20/5 в бессивороточной середовищі, де КЖК - концентрація життєздатних клітин;

Фіг. 4. Нейтралізуюча активність антитіл, що продукуються клітинами клону CHO-Inflix 20/5, щодо ФНП-α людини.

Перелік доданих послідовностей:

Seq ID No 1 - послідовність ДНК, що кодує легку ланцюг химерного антитіла проти ФНП-α людини

Seq ID No 2 - послідовність ДНК, що кодує важку ланцюг химерного антитіла проти ФНП-α людини

Seq ID No 3 - послідовність амінокислот легкої ланцюга химерного антитіла проти ФНП-α людини

Seq ID No 4 - послідовність амінокислот важкої ланцюга химерного антитіла проти ФНП-α людини.

Сутність і переваги винаходу ілюструються такими прикладами:

Приклад 1. Конструювання штучних генів, що кодують легку і важку ланцюга химеишения продуктивності штаму послідовності нуклеотидів у генах, кодують легку (Seq ID No 1) і важку (Seq ID No 2) ланцюга відомого варіанту (UA 2004117915, WO 03042247) химерного антитіла проти ФНП-α людини, конструювали з урахуванням частот використання кодонов в геномі китайського хом'ячка (Cricetulus griseus) з codon usage database [2], при цьому на 5'-кінцях даних генів були поміщені послідовності, що кодують сигнальний пептид з імуноглобуліну миші (MDFQVQIFSFLLISASVIISRG), і послідовності Козак. Фрагменти ДНК, які містять дані гени з додаванням фланкують сайтів рестрикції (BamHI з 5'-кінця і NotI з 3'-кінця), були отримані за допомогою автоматизованого хімічного синтезу та лігування. Отримані фрагменти були клоновані в экспрессионние вектора pIRES-DHFR і pIRES-NEO з отриманням двох экспрессионних плазмід pIRES-DHFR/InflixH (Фіг. 1) і pIRES-NEO/InflixL (Фіг. 2). Правильність складання плазмід і відсутність мутацій в синтезованих генах були перевірені сиквенированием.

Приклад 2. Отримання клітин штаму CHO-Inflix 20/5 - продуцента химерного антитіла проти ФНП-α людини

Клітини лінії яєчників китайського хом'яка, дефектні по дигидрофолатредуктазе (CHOdhfr-), трансфецировали сумішшю плазмід pIRES-DHFR/InflixH і pIRES-NEO/InflixL, взятих у співвідношенні 2:3 і попередньо оброблених рестриктазою PvuI, з допомогою реа�х імуноглобулінів. Тоді клітини були переведені на селективну середу без тимидина і гіпоксантину, що містила 500 мкг/мл G-418. У наступні дні спостерігалося припинення росту, а потім активну відмирання основної маси клітин. Через 12-14 діб було зафіксовано стабільний ріст колоній, стійких до зростання в селективному середовищі. Колонії були пулировани, перенесені в 6-лункові культуральні плати, а потім посіяні по 105клітин на лунку у 4 мл середовища. Через шість діб концентрація антитіл людини в супернатантах склала 507±17 нг/мл Отриманий пул клітин був криоконсервирован, після чого було проведено клонування з метою відбору індивідуальних клонів з високою продукцією рекомбінантних антитіл. Клонування виконувалося методом лімітуючих розведень в 96-лункових платах. Через 10 діб візуально відбирали лунки, містять єдиний клон. Всього було відібрано 295 таких клонів. Далі з допомогою ІФА аналізували зміст людських імуноглобулінів у супернатанте. В результаті скринінгу було відібрано 36 клонів, в супернатантах яких концентрація IgG людини перевищувала 230 нг/мл

Ці клони були перенесені в 12-лункові плати, а потім по досягненні моношару посіяні по 105/лунку в 6-лункові пла�там даного скринінгу було відібрано 9 клонів зі стійкою високою продукцією IgG людини (3 мкг/мл і вище). Далі відібрані кандидатние клони криоконсервировали.

Подальше культивування клітин відібраних клонів і порівняння їх продуктивності показало, що клонами з максимальною питомою і волюметрической продуктивністю і мінімальною швидкістю зростання виявилися клони №7, 11, 19, 20 і 24. Показники цих клонів наведені в таблиці 1.

Далі клітини п'яти кандидатних клонів культивували в присутності поступово зростаючих концентрацій метотрексату (20 нМ - 100 нМ - 500 нМ) для ампліфікації цільових генів. Після успішної адаптації до 500 нМ метотрексату було проведено порівняння волюметрической продукції отриманих клонів. Максимальна концентрація IgG людини в супернатанте виявилася у клону №20 - 35,8 мкг/мл Питома продуктивність при цьому склала 22,3±6,0 пг/кл/сут.

Клітини цього клону були субклонировани з допомогою лімітуючих розведень, проаналізовано 12 субклонов. Клітини висівали по 105/лунку в 6-лункові плати в обсязі 4 мл і вимірювали концентрацію імуноглобулінів в супернатанте через 5, 6 і 7 діб. Результати представлені в таблиці 2.

Максимальна волюметрическая продукція була зафіксована в суперназванние CHO-Inflix 20/5, були розмножені, кріоконсервовані та депоновані в РККК під номером РККК(П)760Д.

Приклад 3. Продукція рекомбінантних антитіл клітинами СНО-Inflix 20/5 в бессивороточной середовищі.

Клітини клону CHO-Inflix 20/5, попередньо адаптовані до суспензионному культивування, засівали в 150 мл бессивороточной середовища CDM4CHO (HyClone), з 6 мМ аланилглутамина в колбу Эрленмейера об'ємом 500 мл (щільність при сівбі 5×105клітин/мл). Далі клітини культивували на шейкері (130 об/хв, 37°С, 5%2) і щодня оцінювали щільність і життєздатність клітин, а також зміст рекомбінантних імуноглобулінів. Результати, представлені на фіг. 3, показують, що максимальна щільність життєздатних клітин спостерігалася на 6 добу та склала 5,0×106/мл На 7 добу життєздатність знизилася до 75%, при цьому концентрація імуноглобулінів склала більше 0,2 г/л

Приклад 4. Очищення рекомбінантного антитіла та аналіз біологічної активності.

На 7 день культивування (приклад 3) клітини штаму CHO-Inflix 20/5 видаляли за допомогою мікрофільтрації та отриману культуральну рідину піддавали трьох-стадійної хроматографічного очищення на аффинном сорбенті з іммобілізованим білком А, аніони Q-Сефарозе XL і катиоо 18 мг високоочищеного антитіла з виходом 70%.

Тестування нейтралізує активності отриманих антитіл проводили в цитотоксическом тесті на клітинній лінії L-929 (колекція ИНЦ РАН). Клітини висівали в щільності 3×104клітин на лунку у 96-лунковий плоскодонна планшет. На наступний день середу в клітинах повністю замінювали на свіжу з додаванням актиноміцина Д (Sigma) у кінцевій концентрації 1 мкг/мл

Антитіло, отриманий з клону CHO-Inflix 20/5, відоме химерное антитіло до ФНП-альфа людини (препарат «Ремікейд»), а також контрольні рекомбінантні людські антитіла, не взаємодіють з ФНП-α, раститровивали в діапазоні концентрацій від 200 до 0,78 нг/мл і інкубували протягом 1 години при кімнатній температурі з ФНП-α людини (ProSpec) в концентрації 1 нг/мл Далі суміші антитіл і ФНП-α людини вносили в планшет з клітинами.

Через 24 год середовище видаляли, клітини фарбували розчином кристалічного фіолетового і висушували. Потім пофарбований осад розчиняли в розчині додецилсульфату натрію з гліцерином і фотометрировали при 595 нм на планшетному лічильнику Victor2. Результати виражали в одиницях оптичної щільності. Результати, представлені на фіг. 4, показують, що продукується клітинами штаму CHO-Inflix 20/5 антитіло ингибиим чином, отриманий штам клітин CHO-Inflix MG20/5 - продуцент химерного антитіла проти рекомбінантного ФНП-α людини, нейтралізують властивості якого ідентичні препарату інфліксімаб (Ремікейд).

Штам клітин яєчників китайського хом'яка CHO-Inflix 20/5, трансфекованих экспрессионними векторами, які містять послідовності ДНК SEQ ID NO:1 і SEQ ID NO:2 - продуцент химерного антитіла до фактору некрозу пухлини альфа людини, депонований у Російську колекції клітинних культур під № РККК(П)760Д.



 

Схожі патенти:

Пептиди, які проникають у клітини, і їх застосування

Винахід відноситься до галузі біотехнології, конкретно до інтерналізації терапевтичних молекул всередину клітини, і може бути використане в медицині. Отримують композицію для доставки молекул нуклеїнових кислот в клітини, що містить щонайменше один пептид з щонайменше 92% ідентичністю до GAAEAAARVYDLGLRRLRQRRRLRRERVRA (SEQ ID NO: 2); IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); або YLKVVRKHHRVIAGQFFGHHHTDSFRMLYD (SEQ ID NO: 4), приєднаний до однієї або кількох молекул нуклеїнових кислот. Винахід дозволяє підвищити ефективність доставки молекул нуклеїнових кислот всередину клітини ссавця за рахунок пептиду, здатного интернализироваться всередину клітини ссавця з ефективністю, що становить щонайменше 200% від ефективності інтерналізації пептиду ТАТ, має аминокислотную послідовність GRKKRRQRRRPPQ (SEQ ID NO: 1). 5 н. і 3 з.п. ф-ли, 16 іл., 1 табл., 8 пр.

Рекомбінантна плазмидная днк, що кодує химерное антитіло проти фактора некрозу пухлини-альфа людини, лінія экуариотических клітин-продуцент химерного антитіла і спосіб отримання химерного антитіла

Група винаходів відноситься до галузі біотехнології. Запропоновано рекомбінантна плазмидная ДНК, що кодує химерное антитіло проти фактора некрозу пухлин-альфа людини (ФНП-альфа), на основі плазміди pOptiVECTM-TOPO®. Розглянуто лінія эукариотических кліток в якості продуцента антитіла проти ФНП-альфа, спосіб її отримання шляхом трансфекції плазмідної ДНК з винаходу, а також спосіб отримання химерного антитіла проти ФНП-альфа шляхом культивування лінії клітин по винаходу. Даний винахід забезпечує збільшення рівня синтезу антитіл проти ФНП-альфа клітинами-продуцентами. 4 н. і 8 з.п. ф-ли, 8 іл., 1 табл., 3 пр.

Члени зв'язування проти il-1r1

Винахід відноситься до галузі біотехнології та імунології. Описано різні варіанти антитіл, специфічні щодо IL-1R1. Розкриті антитіла можуть бути придатні для лікування розладів, опосередкованих IL-1R1, включаючи ревматоїдний артрит, астму, хронічне обструктивне захворювання легень (ХОЗЛ). Запропонована група винаходів може бути використана в медицині. 13 н. і 8 з.п.ф-ли, 14 іл., 12 табл., 5 пр.

Спосіб ідентифікації гетеромультимерних модифікованих убиквитинових білків зі здатністю зв'язуватися з лігандами

Винахід відноситься до галузі біотехнології і може бути використано для ідентифікації гетеромультимерних убиквитинов зі здатністю зв'язуватися з лігандом-антигеном. Спосіб включає контактування сукупності гетеродимерних модифікованих убиквитинов, включають два мономеру убіквітину, пов'язаних між собою за схемою голова до хвоста, з потенційним лігандом дисплейним способом. При цьому кожен із згаданих мономерів модифікований по-різному і містить 5-8 заміщень в положеннях 2, 4, 6, 8, 62, 63, 64, 65, 66 і 68 SEQ ID NO:1. Далі ідентифікують гетеродимерний модифікований білок, связавшийся з лігандом з спорідненістю зв'язування Kd в діапазоні 10-7-10-12 М і одновалентной зв'язує активністю. Запропоновані ДНК-бібліотеки, що відповідають за отримання популяції згаданих гетеромультимерних убиквитинов, а також бібліотеки білків, отримані шляхом експресії згаданих ДНК-бібліотек. Винахід дозволяє отримати нові зв'язуючі білки на основі гетеромультимерного убіквітину, здатні специфічно зв'язуватися з високою спорідненістю з вибраними лігандами. 3 н. і 5 з.п. ф-ли, 17 іл., 4 пр.

Нейтралізуючі антитіла проти вірусу грипу а і їх використання

Пропонований винахід відноситься до імунології. Запропоновані варіанти антитіл, що нейтралізують інфекцію субтипу групи 1 та субтипу групи 2 вірусу грипу А. Антитіло характеризується: або набором 3 CDR легкої і 3 СDR важкої ланцюга, або наявністю варіабельних ділянок легкої і важкої ланцюгів. Розкриті: кодує антитіло молекула нуклеїнової кислоти; экспрессирующая антитіло клітина; а також спосіб ослаблення інфекції вірусу грипу А або зниження його ризику, що використовує антитіло в терапевтично або профілактично ефективному кількості. Використання винаходу забезпечує нейтралізують вірус грипу А антитіла, які можуть знайти застосування в медицині при лікуванні грипу субтипов: H1, H2, H3, H5, H7, H9. 6 н. і 12 з.п. ф-ли, 6 табл., 2 пр.

Вакцини на основі свинячого вірусу torque teno і способи діагностики інфекцій, викликаних цим вірусом

Винаходи стосуються інфекційної молекули нуклеїнової кислоти, кодує інфекційний вірус Torque teNO свиней (PTTV), яка містить щонайменше одну копію геномної послідовності, обраної з групи, що складається з послідовностей, відповідних генотипам або підтипів PTTV1a-VA, PTTV1b-VA, PTTV2b-VA і PTTV2c-VA, а також біологічно функціональної плазміди або вірусного вектора, що містить таку інфекційну нуклеотидну геномну послідовність, і клітини-господаря, що містить таку плазміду або вектор. Крім того, представлені винаходи передбачають живі, аттенюированние, экспрессируемие при використанні вектора і очищені рекомбінантні капсидние субодиничні або вбиті вірусні вакцини для захисту проти PTTV інфекції, а також способи імунізації свиней проти PTTV вірусної інфекції шляхом введення такої вакцини. Охарактеризовані винаходу можуть бути використані для запобігання інфекції, спричиненої вірусом Torque teNO свиней. 11 н. і 12 з.п. ф-ли, 53 іл., 5 табл., 24 пр.

Спосіб отримання системи спрямованої доставки білкових молекул (онколитических білків) в пухлинні тканини на основі активованих лімфоцитів

Винахід відноситься до галузі біотехнології, конкретно до лентивирусной доставки апоптина в пухлинні тканини, і може бути використане в медицині. Спосіб включає отримання лентивірусного конструкта, экспрессирующего модифікований апоптин, злитий з секреторним сигналом лактотрансферрина і трансдукторним сигналом (ST-CTP-апоптин), з подальшим отриманням рекомбінантних лентивирусних частинок, дефектних за реплікації і несучих модифікований апоптин, які потім вводяться в Т-лімфоцити (TILs), отримані при хірургічному видаленні пухлини або в процесі отримання біопсії, які мають здатність проникати в пухлинні тканини. Далі отримані TILs аутотрансплантируют вказаною пацієнту. Винахід дозволяє підвищити здатність апоптина проникати в пухлинні клітини і надавати онколитический ефект у відношенні всіх клітин пухлини. 2 іл., 3 пр.
Винахід відноситься до галузі біотехнології і генетичної інженерії. Запропоновано спосіб отримання щонайменше однієї трансфицированной эукариотической клітини-господаря, экспрессирующей цільовий продукт, що включає введення в клітину полинуклеотида, що кодує цільовий продукт, і полинуклеотида, що кодує мутантний фермент дигидрофолатредуктазу принаймні одним вектором експресії, отримання безлічі эукариотических клітин-господарів, життєздатність яких залежить від споживання фолата, причому зазначені эукариотические клітини-господарі включають щонайменше чужорідний полинуклеотид, що кодує цільовий продукт, і чужорідний полинуклеотид, що кодує фермент дигидрофолатредуктазу (ДГФР), культивування зазначеного безлічі эукариотических кліток-господарів у селективної культуральному середовищі, включає метотрексат у концентрації 2,3-500 нМ і фолієву кислоту в концентрації 12,5-50 нМ, і відбір щонайменше однієї эукариотической клітини-господаря, экспрессирующей цільовий продукт. Також описаний спосіб одержання цільового продукту і клітинної культурального середовища. 3 н. і 8 з.п. ф-ли, 2 табл., 2 пр.

Зв'язують протеїни, специфічні по відношенню до інсулін-подібним факторам зростання, і їх використання

Даний винахід відноситься до галузі імунології. Запропоновано повністю людське моноклональне антитіло, яке зв'язує інсуліноподібний фактор росту-II (IGF-II) і має перехресну реактивність IGF-I, а також його антигенсвязивающий фрагмент. Розглянуто молекула нуклеїнової кислоти, що кодує антитіло щодо винаходу, вектор і клітина-господар для експресії антитіла щодо винаходу. Описана фармацевтична композиція, а також кон'югати для лікування та діагностики злоякісної пухлини, застосування антитіла щодо винаходу в отриманні лікарського засобу та спосіб визначення рівня IGF-II і IGF-I в пробі пацієнта. Даний винахід може знайти подальше застосування в терапії раку. 8 н. і 8 з.п. ф-ли, 27 пр., 18 табл.

Анти-icos антитіла та їх застосування в лікуванні онкологічних, пов'язаних з трансплантацією та аутоімунних захворювань

Винахід відноситься до галузі імунології. Запропоновано виділене антитіло до білка ICOS людини з підвищеною ефекторній функцією. Також описані клітка і спосіб отримання антитіла по справжньому винаходу, фармацевтична композиція, способи лікування аутоімунного захворювання або розлади, відторгнення трансплантата і злоякісності Т-клітин у людини, а також спосіб виснаження ICOS-експресують Т-клітин, спосіб руйнування структури зародкового центру у вторинному лимфоидном органі примату, способи виснаження В-клітин зародкового центру вторинного лімфоїдного органу і циркулюючих В-клітин, які пройшли перемикання класу, у примату. Даний винахід може знайти подальше застосування в терапії захворювань, опосередкованих Т-клітинами. 14 н. і 19 з.п. ф-ли, 21 іл., 3 табл.

Культуральна середовище для епітеліальних стовбурових клітин і органоїдів, що містять зазначені стовбурові клітини

Винахід відноситься до галузі біотехнології. Запропоновано спосіб культивування епітеліальних стовбурових клітин або виділених фрагментів тканини, що містять зазначені епітеліальні стовбурові клітини, що включає забезпечення позаклітинного матриксу, інкубування епітеліальної стовбурової клітини або виділеного фрагмента тканини, що містить зазначені епітеліальні стовбурові клітини, з позаклітинним матриксом, культивування епітеліальної стовбурової клітини або виділеного фрагмента тканини в присутності клітинної культурального середовища, що містить базальну середовище для клітин тварини або людини, в яку додані інгібітор морфогенетичного білка кістки (BMP) і 5 - 500 нг/мл митогенного фактора росту, а також клітинна культуральна середовище, її застосування, спосіб культивування тривимірного органоида, спосіб його отримання, тривимірний органоид і його застосування. 9 н. і 23 з.п. ф-ли, 10 пр., 34 іл.

Культура плюрипотентних стовбурових клітин на микроносителях

Винахід відноситься до біотехнології. Розкрито спосіб вирощування ембріональних стовбурових клітин людини. Спосіб передбачає прикріплення популяції клітин до микроносителю в середовищі, що містить інгібітор Rho-кінази. Далі проводять культивування клітин, відділення клітин від микроносителя і прикріплення отриманих клітин до другого микроносителю в середовищі, що містить інгібітор Rho-кінази. Винахід може бути використаний в медицині. 6 з.п. ф-ли, 48 іл., 3 табл., 11 пр.

Спосіб отримання та індукції спрямованої диференціювання культури мультипотентних клітин легенів

Винахід відноситься до біотехнології та медицині. Запропоновано спосіб диференціювання мезенхімальних стовбурових клітин фиброзированних легенів у фибробластние клітини, що характеризується тим, що з правої частки фиброзированних легенів виділяють клітини з фенотипом мезенхімальних стовбурових клітин (CD44+, CD73+, CD90+, CD106+, CD31-, CD34-, CD45-), здатні самообновляться in vitro протягом 60 днів, потім, при додаванні в культуру мезенхімальних стовбурових клітин фактора росту фібробластів 2 мкг/мл отримують фибробластние клітини. Спосіб дозволяє отримати донорські клітини хворих ідіопатичним з фіброзом тканин фиброзированних легенів. 3 іл., 1 пр.
Винахід відноситься до галузі біотехнології. ЗНК-21/13-13 - перевиваемая монослойно-суспензійна сублиния клітин нирки новонародженого сирійського хом'яка задепонированна в Російській колекції клітинних культур (РКК) у спеціалізованій колекції перещеплюваних соматичних клітинних культур сільськогосподарських і промислових тварин при Всеросійському науково-дослідному інституті експериментальної ветеринарії ім. Я. Р. Коваленко (СХЖ РАСГН) під №89 і призначена для репродукції вірусу ящуру типу А, О, С, Азія-1, CAT-1, CAT-2, CAT-3 і вірусу сказу штам «Щелково-51», які використовуються для виготовлення противірусних вакцин проти ящура та сказу. Результат, що досягається при використанні даної клітинної культури, полягає в підвищенні імуногенності, інфекційності і концентрації клітин ВНК-21/13-13 при промисловому суспензійному культивуванні в біореакторах. 1 табл.

Спосіб отримання популяції клітин, що експресують маркери плюрипотентність і маркери, характерні для лінії сформованої эндодерми

Даний винахід стосується способу отримання популяції клітин, що експресують маркери плюрипотентність і маркери, характерні для лінії сформованої эндодерми. Представлений спосіб передбачає наступні стадії (а) отримання популяції клітин, що експресують маркери HNF-3β, GATA-4, Mixl1, CXCR4, і SOX-17, характерні для лінії сформованої эндодерми, і (b) культивування популяції клітин в умовах гіпоксії на субстраті тканинної культури, не піддаються перед культивуванням попередній обробці білком або экстраклеточним матриксом, у середовищі з додаванням активіну А і ліганду Wnt і IGF-1 або інсуліну, трансферину і селену, де культивовані клітини експресують маркери лінії сформованої эндодерми і маркери плюрипотентність. Охарактеризованное винахід дозволяє отримувати клітини, здатні культивуватися в умовах гіпоксії, що не потребують живлячих ліній клітин, покриттів зі складних білків матриксу і зберігають потенціал диференціювання. 15 з.п. ф-ли, 39 іл., 9 табл., 32 пр.

Тест-система для визначення активності інтерферону людини

Група винаходів відноситься до медицини, а саме до імунології, і може бути використана в лабораторній діагностиці як тест-система і спосіб визначення антивірусної активності інтерферону альфа (ІФН-α) в сироватці крові людини. Тест-система для визначення рівня активності ІФН-α у сироватці крові людини, що включає диплоїдні клітини, вируссодержащую рідину і стандартний інтерферон-α (ІФН-α) людини. Як диплоїдних клітин тест-система включає клітини охарактеризованной лінії диплоїдних клітин - фібробластів людини М-20 на рівні 20-33 пасажів, культивовані в середовищі з додаванням 10% фибринолитически активної плазми (ФАП). А в якості вірусу - адаптований до клітин лінії М-20 вірус везикулярного стоматиту (ВВС), штам Індіана, при цьому тест-система додатково включає вітальний барвник на основі двох флурохромів - тріпафлавіна і родаміну С. Група винаходів включає також спосіб визначення рівня активності ІФН-α у сироватці крові людини з використанням розробленої системи. Використання даних винаходів дозволяє кількісно, з хорошою відтворюваністю, визначити активність ІФН-α у зразках досліджуваної сироватки крові за допомогою люмиил., 1 табл., 4 пр.

Спосіб лікування інфекційного перитоніту в експерименті

Винахід відноситься до медицини, а саме до експериментальної хірургії, і може бути використане для лікування інфекційного перитоніту в експерименті. Для цього щурам внутрішньовенно вводять суспензію алогенних мезенхімальних стовбурових клітин з розрахунку 1,5×106 на 100 г маси тварини у 2 мл фізіологічного розчину. Летальність тварин в основній групі склала 27%, а в контрольній - 94%. Запропонований спосіб лікування інфекційного перитоніту в експерименті відкриває нові можливості використання клітинних технологій для зниження летальності пацієнтів при перитоніті. 11 іл., 1 пр.

Система культивування плюрипотентних стовбурових клітин

Винахід відноситься до галузі біотехнології, зокрема до вирощування колоній клітин. Система культивування плюрипотентних стовбурових клітин складається з сполучених між собою системи управління і блоку культивування. При цьому блок культивування містить один або більше відсіків культивування з встановленими на ньому пристроєм введення агента, змінює эпигенетический статус клітини, принаймні, одним пристроєм введення, принаймні, одного модифікатора, відновлюючого генетичний статус клітки, що відповідає за клітинний цикл, пристроєм введення монооксиду азоту, пристроєм введення інгібітора проліферації та пристроєм для введення інгібітору апоптозу. Причому згадані пристрої виконані з можливістю переміщення по зовнішній стороні блоку культивування плюрипотентних стовбурових клітин і почергового введення їх вмісту у відсіки культивування. Система дозволяє вирощувати плюрипотентні стовбурові клітини, підтримувати їх життєзабезпечення та попереджати канцерогенез згодом отриманих з них диференційованих клітин. 2 з.п. ф-ли, 2 іл., 1 пр.

Спосіб полегшення регенерації

Винахід відноситься до галузі біотехнології та імунології. Розкрито спосіб промоції регенеративних процесів у культурі тканини або культури клітин. Спосіб передбачає введення антитіла, яке пов'язується з кінцевим продуктом глюкурування клітини. Також описано застосування такого антитіла для виробництва лікарського засобу. Винахід може бути використаний в медицині. 2 н. і 10 з.п. ф-ли, 1 іл., 2 пр.

Спосіб отримання системи спрямованої доставки білкових молекул (онколитических білків) в пухлинні тканини на основі активованих лімфоцитів

Винахід відноситься до галузі біотехнології, конкретно до лентивирусной доставки апоптина в пухлинні тканини, і може бути використане в медицині. Спосіб включає отримання лентивірусного конструкта, экспрессирующего модифікований апоптин, злитий з секреторним сигналом лактотрансферрина і трансдукторним сигналом (ST-CTP-апоптин), з подальшим отриманням рекомбінантних лентивирусних частинок, дефектних за реплікації і несучих модифікований апоптин, які потім вводяться в Т-лімфоцити (TILs), отримані при хірургічному видаленні пухлини або в процесі отримання біопсії, які мають здатність проникати в пухлинні тканини. Далі отримані TILs аутотрансплантируют вказаною пацієнту. Винахід дозволяє підвищити здатність апоптина проникати в пухлинні клітини і надавати онколитический ефект у відношенні всіх клітин пухлини. 2 іл., 3 пр.
Винахід відноситься до галузі біотехнології і генетичної інженерії. Запропоновано спосіб отримання щонайменше однієї трансфицированной эукариотической клітини-господаря, экспрессирующей цільовий продукт, що включає введення в клітину полинуклеотида, що кодує цільовий продукт, і полинуклеотида, що кодує мутантний фермент дигидрофолатредуктазу принаймні одним вектором експресії, отримання безлічі эукариотических клітин-господарів, життєздатність яких залежить від споживання фолата, причому зазначені эукариотические клітини-господарі включають щонайменше чужорідний полинуклеотид, що кодує цільовий продукт, і чужорідний полинуклеотид, що кодує фермент дигидрофолатредуктазу (ДГФР), культивування зазначеного безлічі эукариотических кліток-господарів у селективної культуральному середовищі, включає метотрексат у концентрації 2,3-500 нМ і фолієву кислоту в концентрації 12,5-50 нМ, і відбір щонайменше однієї эукариотической клітини-господаря, экспрессирующей цільовий продукт. Також описаний спосіб одержання цільового продукту і клітинної культурального середовища. 3 н. і 8 з.п. ф-ли, 2 табл., 2 пр.
Up!